P62269 RS18_HUMAN
Gene name: RPS18
Protein name: 40S ribosomal protein S18
List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- nucleobase-containing compound catabolic process GO:0034655
- protein targeting GO:0006605
- protein transport GO:0015031
- translation GO:0006412
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96FX7 | TRMT61A | 0.8162 | cellular nitrogen compound metabolic process GO:0034641 |
| 2 | O76093 | FGF18 | 0.71726 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 3 | Q13418 | ILK | 0.70014 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 4 | O43464 | HTRA2 | 0.67481 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell cycle GO:0007049 ... |
| 5 | Q99784 | OLFM1 | 0.66705 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell death GO:0008219 ... |
| 6 | Q9NZ43 | USE1 | 0.64013 | catabolic process GO:0009056 protein transport GO:0015031 transport GO:0006810 ... |
| 7 | Q9HAV5 | EDA2R | 0.6281 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 8 | O43193 | MLNR | 0.60816 | signal transduction GO:0007165 |
| 9 | Q96RI0 | F2RL3 | 0.59929 | homeostatic process GO:0042592 response to stress GO:0006950 signal transduction GO:0007165 ... |
| 10 | Q9NQ25 | SLAMF7 | 0.57735 | cell adhesion GO:0007155 immune system process GO:0002376 response to stress GO:0006950 |
20 40 60 80 100 AA: MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELTEDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLA STMI: DO_DISOPRED3: DD.................................................................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDD................................................................................................ CONSENSUS: DD.................................................................................................. CONSENSUS_MOBI: DD..................................................................................................
120 140 AA: NGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK STMI: DO_DISOPRED3: ..........................................DDDDDDDDDD DO_IUPRED2A: .................................DD.DDDDDDDDDDDDDDDD DO_SPOTD: ....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: .................................DDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: .................................................... RICH_[RT]: TkTTgRRgRT RICH_[T]: TkTTgrrgrT RICH_[GT]: TTGrrGrTvG