P62269 RS18_HUMAN

Gene name: RPS18
Protein name: 40S ribosomal protein S18

List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- nucleobase-containing compound catabolic process GO:0034655
- protein targeting GO:0006605
- protein transport GO:0015031
- translation GO:0006412
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q96FX7 TRMT61A 0.8162 cellular nitrogen compound metabolic process GO:0034641
2 O76093 FGF18 0.71726 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
3 Q13418 ILK 0.70014 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
4 O43464 HTRA2 0.67481 anatomical structure development GO:0048856
catabolic process GO:0009056
cell cycle GO:0007049
...
5 Q99784 OLFM1 0.66705 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell death GO:0008219
...
6 Q9NZ43 USE1 0.64013 catabolic process GO:0009056
protein transport GO:0015031
transport GO:0006810
...
7 Q9HAV5 EDA2R 0.6281 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell death GO:0008219
...
8 O43193 MLNR 0.60816 signal transduction GO:0007165
9 Q96RI0 F2RL3 0.59929 homeostatic process GO:0042592
response to stress GO:0006950
signal transduction GO:0007165
...
10 Q9NQ25 SLAMF7 0.57735 cell adhesion GO:0007155
immune system process GO:0002376
response to stress GO:0006950

                                           20                  40                  60                  80                 100
AA:                      MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELTEDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLA
STMI:                                                                                                                        
DO_DISOPRED3:            DD..................................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DDDD................................................................................................
CONSENSUS:               DD..................................................................................................
CONSENSUS_MOBI:          DD..................................................................................................

                                          120                 140        
AA:                      NGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK
STMI:                                                                        
DO_DISOPRED3:            ..........................................DDDDDDDDDD
DO_IUPRED2A:             .................................DD.DDDDDDDDDDDDDDDD
DO_SPOTD:                ....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               .................................DDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ....................................................
RICH_[RT]:                                                  TkTTgRRgRT       
RICH_[T]:                                                   TkTTgrrgrT       
RICH_[GT]:                                                    TTGrrGrTvG