P62877 RBX1_HUMAN

Gene name: RBX1
Protein name: E3 ubiquitin-protein ligase RBX1

List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cell cycle GO:0007049
- cell-cell signaling GO:0007267
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- chromosome organization GO:0051276
- DNA metabolic process GO:0006259
- mitotic cell cycle GO:0000278
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40                  60                  80                 100
AA:                      MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNRE
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDD...................................................................................
DO_IUPRED2A:             ..........D.........................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDD..................................................................................
CONSENSUS:               DDDDDDDDDDDDDDDDD...................................................................................
CONSENSUS_MOBI:          DDDDDDDDD...........................................................................................

                                     
AA:                      WEFQKYGH
STMI:                            
DO_DISOPRED3:            ........
DO_IUPRED2A:             ........
DO_SPOTD:                ....DDDD
CONSENSUS:               ........
CONSENSUS_MOBI:          ........