P63165 SUMO1_HUMAN

Gene name: SUMO1
Protein name: Small ubiquitin-related modifier 1

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- circulatory system process GO:0003013
- DNA metabolic process GO:0006259
- immune system process GO:0002376
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- signal transduction GO:0007165
- transmembrane transport GO:0055085
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40                  60                  80                 100
AA:                      MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHST
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDD.....................................................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDD..................................D................DD...DDDDDDDDDDDDDDDDDDDDDDD..DDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDD.............................................................................DDDDD
CONSENSUS:               DDDDDDDDDDDDDDDD.................................................................................DDD
CONSENSUS_MOBI:          ....................................................................................................

                                            
AA:                      V
STMI:                     
DO_DISOPRED3:            .
DO_IUPRED2A:             D
DO_SPOTD:                D
CONSENSUS:               D
CONSENSUS_MOBI:          .