P82909 RT36_HUMAN

Gene name: MRPS36
Protein name: 28S ribosomal protein S36, mitochondrial

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- small molecule metabolic process GO:0044281
- translation GO:0006412

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q12791 KCNMA1 0.70408 cell death GO:0008219
circulatory system process GO:0003013
homeostatic process GO:0042592
...
2 O43166 SIPA1L1 0.67269 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell junction organization GO:0034330
...
3 Q96NE9 FRMD6 0.65589 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
4 P61073 CXCR4 0.6268 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biological process involved in symbiotic interaction GO:0044403
...
5 Q96QZ7 MAGI1 0.62656 cell adhesion GO:0007155
cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
...
6 O15075 DCLK1 0.61252 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
7 O60307 MAST3 0.61231 cellular protein modification process GO:0006464
cytoskeleton organization GO:0007010
signal transduction GO:0007165
8 P04049 RAF1 0.60498 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell death GO:0008219
...
9 Q9UJD0 RIMS3 0.59776 cell-cell signaling GO:0007267
transport GO:0006810
vesicle-mediated transport GO:0016192
10 Q13009 TIAM1 0.5901 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell death GO:0008219
...

                                           20                  40                  60                  80                 100
AA:                      MMGSKMASASRVVQVVKPHTPLIRFPDRRDNPKPNVSEALRSAGLPSHSSVISQHSKGSKSPDLLMYQGPPDTAEIIKTLPQKYRRKLVSQEEMEFIQRG
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDD...............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................
DO_IUPRED2A:             DDDDD..DDDDDDD...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDD.D..DDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................
CONSENSUS_MOBI:          ...................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............................
RICH_[RV]:                         RVVqVVkphtpliRfpdRR                                                                       
RICH_[R]:                          RvvqvvkphtpliRfpdRR                                                                       
RICH_[S]:                                                    SealrSaglpShSSviSqhSkgSkS                                       
RICH_[HS]:                                                        SaglpSHSSviSqHS                                            
RICH_[MV]:               MMgskMasasrVVqVV                                                                                    
RICH_fLPS_[V]:                 asasrVVqVV                                                                                    
RICH_fLPS_[VM]:          MMgskMasasrVVqVV                                                                                    
RICH_fLPS_[M]:           MMgskMasas                                                                                          
RICH_MOBI_[R]:                                  RfpdRRdnpkpnvsealR                                                           
RICH_MOBI_[S]:                                                    SaglpShSSviSqhSkgSkS                                       
RICH_MOBI_[HS]:                                                   SaglpSHSSviSqHS                                            

                                          
AA:                      GPE
STMI:                       
DO_DISOPRED3:            .DD
DO_IUPRED2A:             DDD
DO_SPOTD:                DDD
CONSENSUS:               DDD
CONSENSUS_MOBI:          ...