P82912 RT11_HUMAN
Gene name: MRPS11
Protein name: 28S ribosomal protein S11, mitochondrial
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- ribonucleoprotein complex assembly GO:0022618
- ribosome biogenesis GO:0042254
- translation GO:0006412
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q68BL8 | OLFML2B | 0.53639 | |
| 2 | Q8NCW0 | KREMEN2 | 0.51233 | anatomical structure development GO:0048856 cell-cell signaling GO:0007267 signal transduction GO:0007165 |
| 3 | P54727 | RAD23B | 0.49771 | anatomical structure development GO:0048856 catabolic process GO:0009056 cellular component assembly GO:0022607 ... |
| 4 | Q8NDG6 | TDRD9 | 0.48449 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell differentiation GO:0030154 ... |
| 5 | Q8N446 | ZNF843 | 0.46926 | |
| 6 | P0C7N4 | TMEM191B | 0.4664 | |
| 7 | Q14117 | DPYS | 0.4664 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 nucleobase-containing compound catabolic process GO:0034655 ... |
| 8 | A6NGB0 | TMEM191C | 0.46381 | |
| 9 | Q14CZ0 | C16orf72 | 0.46273 | |
| 10 | P10745 | RBP3 | 0.44837 | nervous system process GO:0050877 |
20 40 60 80 100 AA: MQAVRNAGSRFLRSWTWPQTAGRVVARTPAGTICTGARQLQDAAAKQKVEQNAAPSHTKFSIYPPIPGEESSLRWAGKKFEEIPIAHIKASHNNTQIQVV STMI: DO_DISOPRED3: DDDDDDD..................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................... DO_IUPRED2A: ...........................DD......DDD.....DDDDDDDDD..D.DDDDDD.D.........D...........D.........DD... DO_SPOTD: DDDDDD......................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DD....................... CONSENSUS: DDDDDD.....................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................... RICH_MOBI_[AQ]: ArQlQdAAAkQkveQnAA RICH_MOBI_[AT]: TAgrvvArTpAgTicTgA RICH_MOBI_[AV]: AgrVVArtpA RICH_MOBI_[A]: ArtpAgtictgArqlqdAAAkqkveqnAA RICH_MOBI_[RW]: RnagsRflRsWtWpqtagR RICH_MOBI_[Q]: QlQdaaakQkveQ RICH_MOBI_[R]: RnagsRflRswtwpqtagR RICH_MOBI_[T]: TwpqTagrvvarTpagTicT RICH_MOBI_[TW]: WTWpqTagrvvarTpagT
120 140 160 180 AA: SASNEPLAFASCGTEGFRNAKKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGPGRLSAMHGLIMGGLEVISITDNTPIPHNGCRPRKARKL STMI: DO_DISOPRED3: .........................................................................................DDDDD DO_IUPRED2A: ................................................................................DDDDDDDDDDDDDD DO_SPOTD: ....................................................................................DDDDDDDDDD CONSENSUS: ....................................................................................DDDDDDDDDD CONSENSUS_MOBI: ..............................................................................................