P83731 RL24_HUMAN

Gene name: RPL24
Protein name: 60S ribosomal protein L24

List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- nucleobase-containing compound catabolic process GO:0034655
- protein targeting GO:0006605
- protein transport GO:0015031
- protein-containing complex assembly GO:0065003
- ribonucleoprotein complex assembly GO:0022618
- ribosome biogenesis GO:0042254
- translation GO:0006412
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P62424 RPL7A 0.86896 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
2 P07305 H1-0 0.84782 biosynthetic process GO:0009058
catabolic process GO:0009056
cell death GO:0008219
...
3 P16401 H1-5 0.81521 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular component assembly GO:0022607
...
4 Q8IZA3 H1-8 0.81277 biosynthetic process GO:0009058
cell cycle GO:0007049
cell differentiation GO:0030154
...
5 Q5QNW6 H2BC18 0.8119 cellular component assembly GO:0022607
chromosome organization GO:0051276
protein-containing complex assembly GO:0065003
6 Q02539 H1-1 0.80701 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
7 P36578 RPL4 0.80066 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
8 Q9UNZ5 C19orf53 0.79561
9 P16402 H1-3 0.79399 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
10 P16403 H1-2 0.79336 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...

                                           20                  40                  60                  80                 100
AA:                      MKVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCESAFLSKRNPRQINWTVLYRRKHKKGQSEEIQKKRTRRAVKFQRAITGASLADIMAKRNQKPEV
STMI:                                                                                                                        
DO_DISOPRED3:            D...................................................................................................
DO_IUPRED2A:             ..................................................DDDDDD...DDDDDDDDDDDDDDDDD.DD.........DDDDDDDDDDDD
DO_SPOTD:                ............................................D..............DDDDDDDDDDDDDDDDDDDDDDDDDDDD.......DDDDDD
CONSENSUS:               ...........................................................DDDDDDDDDDDDDDDDDDDD...............DDDDDD
CONSENSUS_MOBI:          ....................................................................................................
RICH_[AK]:                                                                                                               Kpev
RICH_[K]:                                                                           KKgqseeiqKKrtrravK                   Kpev

                                          120                 140   
AA:                      RKAQREQAIRAAKEAKKAKQASKKTAMAAAKAPTKAAPKQKIVKPVKVSAPRVGGKR
STMI:                                                                             
DO_DISOPRED3:            ........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ..........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[AK]:               rKAqreqAirAAKeAKKAKqAsKKtAmAAAKAptKAApKqKivKpvKvsA       
RICH_[AP]:                                              APtkAAPkqkivkPvkvsAP      
RICH_[A]:                  AqreqAirAAkeAkkAkqAskktAmAAAkAptkAA                    
RICH_[K]:                rKaqreqairaaKeaKKaKqasKKtamaaaKaptKaapKqKivKpvKvsaprvggK 
RICH_[V]:                                                          VkpVkVsaprV    
RICH_[KP]:                                               PtKaaPKqKivKPvKvsaP      
RICH_[KV]:                                                 KaapKqKiVKpVKVsaprVggK 
RICH_fLPS_[A]:                  AirAAkeAkkAkqAskktAmAAAkAptkAA                    
RICH_fLPS_[V]:                                                     VkpVkVsaprV    
RICH_fLPS_[AK]:                 AirAAKeAKKAKqAsKKtAmAAAKAptKAApKqK                
RICH_fLPS_[K]:                       KeaKKaKqasKKtamaaaKaptKaapKqKivKpvK          
RICH_MOBI_[AK]:                                     AAAKAptKAApKqKivKpvKvsA       
RICH_MOBI_[A]:                                      AAAkAptkAA                    
RICH_MOBI_[K]:                                         KaptKaapKqKivKpvKvsaprvggK 
RICH_MOBI_[V]:                                                     VkpVkVsaprV    
RICH_MOBI_[KV]:                                            KaapKqKiVKpVKVsaprVggK 
RICH_fLPS_MOBI_[A]:                                mAAAkAptkAApkqk                
RICH_fLPS_MOBI_[K]:                                 aaaKaptKaapKqKivKpvK