P83859 OX26_HUMAN

Gene name: QRFP
Protein name: Orexigenic neuropeptide QRFP

List of terms from Generic GO subset, which this protein is a part of:
- circulatory system process GO:0003013
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q05481 ZNF91 0.73106 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
DNA metabolic process GO:0006259
2 Q8NGC7 OR11H6 0.70711
3 Q8N587 ZNF561 0.70711 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
4 Q5I0G3 MDH1B 0.68045 carbohydrate metabolic process GO:0005975
generation of precursor metabolites and energy GO:0006091
small molecule metabolic process GO:0044281
5 Q9H8S9 MOB1A 0.67572 signal transduction GO:0007165
6 Q9NR11 ZNF302 0.63158 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
7 P43155 CRAT 0.5932 catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
protein targeting GO:0006605
...
8 Q5T655 CFAP58 0.5748
9 Q6V9R5 ZNF562 0.574 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
10 P43657 LPAR6 0.55411 anatomical structure development GO:0048856
embryo development GO:0009790
homeostatic process GO:0042592
...

                                           20                  40                  60                  80                 100
AA:                      MVRPYPLIYFLFLPLGACFPLLDRREPTDAMGGLGAGERWADLAMGPRPHSVWGSSRWLRASQPQALLVIARGLQTSGREHAGCRFRFGRQDEGSEATGF
STMI:                    SSSSSSSSSSSSSSSSSS                                                                                  
DO_DISOPRED3:            DDD.................................................................................DDDDDDDDDDDDDDDD
DO_IUPRED2A:             ....................................................................................DD..........DDDD
DO_SPOTD:                DDD....................DDDDDDDDDDDDDDD.......................................DDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                 ..................................................................DDDDDDDDDDDDDDDD
CONSENSUS_MOBI:                            ..................................................................................
RICH_[F]:                                                                                                     FrFgrqdegseatgF

                                          120    
AA:                      LPAAGEKTSGPLGNLAEELNGYSRKKGGFSFRFGRR
STMI:                                                        
DO_DISOPRED3:            DDDD................................
DO_IUPRED2A:             DDDD...D..DD.DDDDD..................
DO_SPOTD:                DDDDDDDDDD..........D.DDDDDD.....DDD
CONSENSUS:               DDDDDDDD............................
CONSENSUS_MOBI:          ....................................