P83916 CBX1_HUMAN
Gene name: CBX1
Protein name: Chromobox protein homolog 1
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O60841 | EIF5B | 0.86627 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 2 | Q99442 | SEC62 | 0.85347 | protein targeting GO:0006605 protein transport GO:0015031 transmembrane transport GO:0055085 ... |
| 3 | P07900 | HSP90AA1 | 0.84648 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 4 | Q92769 | HDAC2 | 0.84283 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 5 | P26358 | DNMT1 | 0.84138 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 6 | Q99549 | MPHOSPH8 | 0.83598 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 cellular component assembly GO:0022607 ... |
| 7 | Q06323 | PSME1 | 0.83499 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 8 | Q9Y3E1 | HDGFL3 | 0.82742 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular component assembly GO:0022607 ... |
| 9 | P29374 | ARID4A | 0.82158 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 10 | Q58FG0 | HSP90AA5P | 0.82138 | protein folding GO:0006457 |
20 40 60 80 100 AA: MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKP STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDD.................................................................DDDDDDDDDDDDDDDDDD DO_IUPRED2A: DDDDDDDDDDDD..D...................................DDDDDDD.....DD....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_SPOTD: DDDDDDDDDDDDDDDDD........................................................DDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: DDDDDDDDDDDDDDDDD........................................................DDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ........................................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDD RICH_[D]: DkseggkrkaDsDseD RICH_[E]: EdkgEEskp RICH_[K]: KseggKrKadsdsedKgeesKp RICH_[DE]: DksEggkrkaDsDsEDkgEE RICH_[DK]: DKseggKrKaDsDseDK RICH_[EK]: KKqnKKKvEEvlEEE KsEggKrKadsdsEdKgEEsKp RICH_fLPS_[K]: KrKadsdsedKgeesKp RICH_MOBI_[D]: DkseggkrkaDsDseD RICH_MOBI_[E]: EdkgEEskp RICH_MOBI_[K]: KseggKrKadsdsedKgeesKp RICH_MOBI_[DE]: DksEggkrkaDsDsEDkgEE RICH_MOBI_[DK]: DKseggKrKaDsDseDK RICH_MOBI_[EK]: KsEggKrKadsdsEdKgEEsKp
120 140 160 180 AA: KKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN STMI: DO_DISOPRED3: D..........................................................................DDDDDDDDDD DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDD.........DD.........DDDDDDDD...................DDDDDDDDDDDDDD DO_SPOTD: DDDDDDDDDDDDDDD..........................................................DDDDDDDDDDDD CONSENSUS: DDDDDDDDDDDDDDD..........................................................DDDDDDDDDDDD CONSENSUS_MOBI: DDDDDDD....................................................................DDDDDDDDDD RICH_[E]: kkkkEEsE RICH_[K]: KKKKeeseK RICH_[EK]: KKKKEE RICH_fLPS_[K]: KKKKeeseK RICH_MOBI_[E]: kkkkEE RICH_MOBI_[K]: KKKK RICH_MOBI_[EK]: KKKKEE RICH_fLPS_MOBI_[D]: eDDDkkDDkn