P84098 RL19_HUMAN
Gene name: RPL19
Protein name: 60S ribosomal protein L19
List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- nucleobase-containing compound catabolic process GO:0034655
- protein targeting GO:0006605
- protein transport GO:0015031
- translation GO:0006412
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6PH81 | C16orf87 | 0.75432 | |
| 2 | O76083 | PDE9A | 0.73288 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 3 | Q13573 | SNW1 | 0.73148 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 4 | Q8TDI7 | TMC2 | 0.71563 | nervous system process GO:0050877 transmembrane transport GO:0055085 transport GO:0006810 |
| 5 | Q8N3Z0 | PRSS35 | 0.70287 | |
| 6 | P0DPH9 | CXorf51B | 0.69425 | |
| 7 | Q96MF4 | CCDC140 | 0.68432 | |
| 8 | Q96MW1 | CCDC43 | 0.68064 | |
| 9 | Q9H6E4 | CCDC134 | 0.67729 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 embryo development GO:0009790 ... |
| 10 | Q9Y3C1 | NOP16 | 0.67482 | ribosome biogenesis GO:0042254 |
20 40 60 80 100 AA: MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSRARCRKNTLARRKGRHMGIGKRKGTANARMPEKVTWMRRMR STMI: DO_DISOPRED3: D......................................................................DD....DDDD................... DO_IUPRED2A: ...........................DDD...DDDDD......................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......... DO_SPOTD: DDDDDDD..............................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......... CONSENSUS: D...........................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......... CONSENSUS_MOBI: .................................................................................................... RICH_[K]: KntlarrKgrhmgigKrK RICH_[R]: RcRkntlaRRkgRhmgigkRkgtanaR RICH_[GK]: KntlarrKGrhmGiGKrKG RICH_[GR]: RkntlaRRkGRhmGiGkRkGtanaR RICH_[KR]: RKntlaRRKgRhmgigKRK
120 140 160 180 AA: ILRRLLRRYRESKKIDRHMYHSLYLKVKGNVFKNKRILMEHIHKLKADKARKKLLADQAEARRSKTKEARKRREERLQAKKEEIIKTLSKEEETKK STMI: DO_DISOPRED3: ......................................................................................DDDDDDDDDD DO_IUPRED2A: .........................................DDD....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...D.DDDD...DD DO_SPOTD: ...........................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ...........................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ........................................................DDDDDDDDDDDDDDDDDDDD.................... RICH_[E]: EErlqakkEEiiktlskEEE RICH_[K]: KtKearKrreerlqaKKeeiiKtlsKeeetKK RICH_[R]: RRsktkeaRkRReeR RICH_[EI]: EEIIktlskEEE RICH_[EK]: KtKEarKrrEErlqaKKEEiiKtlsKEEEtKK RICH_[ER]: EaRRsktkEaRkRREER RICH_[IK]: KKeeIIKtlsK RICH_[KR]: RRsKtKeaRKRReeRlqaKKeeiiK RICH_fLPS_[R]: eaRRsktkeaRkRReeRlqa RICH_MOBI_[R]: RRsktkeaRkRReeR RICH_MOBI_[ER]: EaRRsktkEaRkRREER RICH_MOBI_[KR]: RRsKtKeaRKRR