Q02575 HEN1_HUMAN

Gene name: NHLH1
Protein name: Helix-loop-helix protein 1

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell differentiation GO:0030154
- cellular nitrogen compound metabolic process GO:0034641

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q5U4P2 ASPHD1 0.75535 cellular protein modification process GO:0006464
2 Q9NXH8 TOR4A 0.74095 transport GO:0006810
vesicle-mediated transport GO:0016192
3 P50895 BCAM 0.74003 cell adhesion GO:0007155
signal transduction GO:0007165
4 P0DMV9 HSPA1B 0.73738 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
5 A6NCS4 NKX2-6 0.72037 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell death GO:0008219
...
6 Q96NA8 TSNARE1 0.7145 membrane organization GO:0061024
protein transport GO:0015031
transport GO:0006810
...
7 Q9HCR9 PDE11A 0.71426 signal transduction GO:0007165
8 A6NHQ2 FBLL1 0.71406 anatomical structure development GO:0048856
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
9 P11142 HSPA8 0.71245 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
10 Q96EG3 ZNF837 0.69606

                                           20                  40                  60                  80                 100
AA:                      MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEPGEPGRKDLQHLSREERRRRRRATAKYRTAHATRERIRVEAFNLAFAELRK
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................
RICH_[AR]:                                                                                    RRAtAkyRtA                     
RICH_[G]:                                     GfsdcGGGaGpdGaGpGGpGGGqarGpepGepG                                              
RICH_[R]:                                                                      RkdlqhlsReeRRRRRRatakyR                       
RICH_[ER]:                                                               EpgEpgRkdlqhlsREERRR                                
RICH_[GP]:                                           GaGPdGaGPGGPGGGqarGPePGePG                                              
RICH_fLPS_[R]:                                                                 RkdlqhlsReeRRRRRRatakyR                       
RICH_fLPS_[G]:                                     GGGaGpdGaGpGGpGGGqarGpepGepG                                              
RICH_fLPS_[M]:           MMlnsdtMel                                                                                          
RICH_MOBI_[AR]:                                                                               RRAtAkyRtA                     
RICH_MOBI_[G]:                                GfsdcGGGaGpdGaGpGGpGGGqarGpepGepG                                              
RICH_MOBI_[R]:                                                                 RkdlqhlsReeRRRRRRatakyR                       
RICH_MOBI_[ER]:                                                          EpgEpgRkdlqhlsREERRR                                
RICH_MOBI_[LM]:          MMLnsdtMeLdL                                                                                        
RICH_fLPS_MOBI_[R]:                                                            RkdlqhlsReeRRRRRRatakyR                       
RICH_fLPS_MOBI_[G]:                                GGGaGpdGaGpGGpGGGqarGpepGepG                                              
RICH_fLPS_MOBI_[M]:      MMlnsdtMeldlppt                                                                                     

                                          120       
AA:                      LLPTLPPDKKLSKIEILRLAICYISYLNHVLDV
STMI:                                                     
DO_DISOPRED3:            .................................
DO_IUPRED2A:             .................................
DO_SPOTD:                .................................
CONSENSUS:               .................................
CONSENSUS_MOBI:          .................................