Q05BU3 F86JP_HUMAN

Gene name: FAM86JP
Protein name: Putative protein FAM86JP

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 A8MYJ7 TTC34 0.8145
2 Q8N2I9 STK40 0.81297 anatomical structure development GO:0048856
carbohydrate metabolic process GO:0005975
cell death GO:0008219
...
3 Q96HE8 TMEM80 0.80889 cellular component assembly GO:0022607
4 P41143 OPRD1 0.7772 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
5 P39905 GDNF 0.7602 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
6 Q9NPI5 NMRK2 0.75421 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
7 Q8TAD2 IL17D 0.74421 anatomical structure development GO:0048856
immune system process GO:0002376
response to stress GO:0006950
8 Q92673 SORL1 0.73289 anatomical structure development GO:0048856
catabolic process GO:0009056
cell death GO:0008219
...
9 Q5VT28 FAM27B 0.72864
10 Q96BM1 ANKRD9 0.72822 cellular protein modification process GO:0006464

                                           20
AA:                      MPGAFSQNSSKRRAVLPRSHRVAGRGPAEAGCLPGAPAGS
STMI:                                                            
DO_DISOPRED3:            DDDD...D.............................DDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[AG]:                                     AGrGpAeAGclpGApAG 
RICH_[AR]:                          RRAvlpRshRvAgRgpAeA          
RICH_[R]:                           RRavlpRshRvagR               
RICH_MOBI_[AG]:                                AGrGpAeAGclpGApAG 
RICH_MOBI_[AR]:                     RRAvlpRshRvAgRgpAeA          
RICH_MOBI_[RV]:                      RaVlpRshRV                  
RICH_MOBI_[R]:                      RRavlpRshRvagR