Q06250 WIT1_HUMAN

Gene name: WT1-AS
Protein name: Putative Wilms tumor upstream neighbor 1 gene protein

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9NY47 CACNA2D2 0.75653 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell junction organization GO:0034330
...
2 Q9BYM8 RBCK1 0.72822 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
3 Q9Y242 TCF19 0.69913
4 Q9GZM8 NDEL1 0.69552 anatomical structure development GO:0048856
cell cycle GO:0007049
cell differentiation GO:0030154
...
5 Q8N6W0 CELF5 0.68342 cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
...
6 Q5VZI3 TMEM268 0.68155
7 Q96PM9 ZNF385A 0.66023 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
8 Q04118 PRB3 0.65792 response to stress GO:0006950
9 Q1L6U9 MSMP 0.6482 immune system process GO:0002376
response to stress GO:0006950
10 P42768 WAS 0.63257 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell morphogenesis GO:0000902
...

                                           20                  40                  60                  80        
AA:                      MQRRGQPLENHVALIHWQSAGIPASKVHNYCNMKKSRLGRSRAVRISQPLLSPRRCPLHLTERGAGLLQPQPQGPVRTPGPPSGSHPAAADN
STMI:                                                                                                                
DO_DISOPRED3:            DDDDD......................................................................DDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDD..D......DDDDDDDDDDD.DD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDD.D..........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDD................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ...........................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[PQ]:                                                                                   QPQPQgPvrtPgPP          
RICH_[L]:                                                                 LLsprrcpLhLtergagLL                        
RICH_[P]:                                                                                     PqPqgPvrtPgPPsgshP     
RICH_[R]:                                                    RlgRsRavRisqpllspRR                                     
RICH_[GP]:                                                                              GaGllqPqPqGPvrtPGPPsG        
RICH_[KN]:                                        KvhNycNmKK                                                         
RICH_[LP]:                                                                   PrrcPLhLtergagLLqPqP                    
RICH_[LR]:                                                        RavRisqpLLspRRcpLhL                                
RICH_MOBI_[PQ]:                                                                              QPQPQgPvrtPgPP          
RICH_MOBI_[P]:                                                                                PqPqgPvrtPgPPsgshP     
RICH_MOBI_[GP]:                                                                         GaGllqPqPqGPvrtPGPPsG        
RICH_MOBI_[LQ]:                                                                     LtergagLLQpQpQ