Q06830 PRDX1_HUMAN
Gene name: PRDX1
Protein name: Peroxiredoxin-1
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q29980 | MICB | 0.99512 | biological process involved in symbiotic interaction GO:0044403 immune system process GO:0002376 response to stress GO:0006950 ... |
| 2 | Q6ZN84 | CCDC81 | 0.9224 | |
| 3 | Q13772 | NCOA4 | 0.91892 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 4 | Q96PP4 | TSGA13 | 0.89755 | |
| 5 | Q9Y4P3 | TBL2 | 0.89443 | |
| 6 | Q6PIZ9 | TRAT1 | 0.88309 | immune system process GO:0002376 response to stress GO:0006950 signal transduction GO:0007165 ... |
| 7 | Q9NZ09 | UBAP1 | 0.87807 | biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 protein transport GO:0015031 ... |
| 8 | O96001 | PPP1R17 | 0.87594 | anatomical structure development GO:0048856 signal transduction GO:0007165 |
| 9 | Q9H3H1 | TRIT1 | 0.86746 | cellular nitrogen compound metabolic process GO:0034641 |
| 10 | P32314 | FOXN2 | 0.85176 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
20 40 60 80 100 AA: MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPM STMI: DO_DISOPRED3: DDDD................................................................................................ DO_IUPRED2A: ...D..............................................................................................DD DO_SPOTD: DDDDDD.............................................................................................. CONSENSUS: DDDD................................................................................................ CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 AA: NIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK STMI: DO_DISOPRED3: ................................................................................................... DO_IUPRED2A: D..........................................................................DD.DDD.DD...DD.....D.... DO_SPOTD: .................................................................................................DD CONSENSUS: ................................................................................................... CONSENSUS_MOBI: .......................................................................................DDDDDDDDDDDD RICH_MOBI_[K]: KsKeyfsKqK