Q0D2K3 RIPP1_HUMAN

Gene name: RIPPLY1
Protein name: Protein ripply1

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- embryo development GO:0009790

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8IYE0 CCDC146 0.79783
2 Q96I76 GPATCH3 0.77524 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
immune system process GO:0002376
...
3 Q9Y5Q8 GTF3C5 0.77062 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
4 O75155 CAND2 0.76642 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
5 Q9UKN5 PRDM4 0.76338 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
6 Q9HBG6 IFT122 0.75167
7 Q8IWA0 WDR75 0.71459 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
8 Q8NG66 NEK11 0.71053 cell cycle GO:0007049
cellular protein modification process GO:0006464
chromosome organization GO:0051276
...
9 Q9UKP3 ITGB1BP2 0.70878 anatomical structure development GO:0048856
signal transduction GO:0007165
10 Q5SVQ8 ZBTB41 0.70284

                                           20                  40                  60                  80                 100
AA:                      MDSAACAAAATPVPALALALAPDLAQAPLALPGLLSPSCLLSSGQEVNGSERGTCLWRPWLSSTNDSPRQMRKLVDLAAGGATAAEVTKAESKFHHPVRL
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................D..DDDDDDDD...................
DO_IUPRED2A:             ......................................................................DDDDDD...........DD...........
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................DDDDDDDDDDD......DD...........
CONSENSUS_MOBI:          ....................................................................................................
RICH_[AL]:                   AcAAAAtpvpALALALApdLAqApLALpgLLspscL                                                            
RICH_[AP]:                       AAtPvPAlAlAlAPdlAqAPlAlP                                                                    
RICH_[A]:                   AAcAAAAtpvpAlAlAlApdlAqAplA                                                                      
RICH_[L]:                               LaLaLapdLaqapLaLpgLLspscLL                                                           
RICH_[LP]:                          PvPaLaLaLaPdLaqaPLaLP                                                                    
RICH_[LS]:                                                LLSpScLLSS                                                         
RICH_fLPS_[A]:              AAcAAAAtpvpAlAlAlApdlAqAplA                                                                      
RICH_fLPS_[AL]:             AAcAAAAtpvpALALALApdLAqApLALpgLLspscLL                                                           
RICH_fLPS_[L]:                          LaLaLapdLaqapLaLpgLLspscLL                                                           

                                          120                 140         
AA:                      FWPKSRSFDYLYSAGEILLQNFPVQATINLYEDSDSEEEEEDEEQEDEEEK
STMI:                                                                       
DO_DISOPRED3:            .................................DDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             .............................DDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                .................................DDDDDDDDDDDDDDDDDD
CONSENSUS:               .................................DDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .............................DDDDDDDDDDDDDDDDDDDDDD
RICH_[E]:                                                    EEEEEdEEqEdEEE 
RICH_[DE]:                                                 DsEEEEEDEEqEDEE  
RICH_MOBI_[D]:                                           DsDseeeeeDeeqeD    
RICH_MOBI_[E]:                                          EdsdsEEEEEdEEqEdEEE 
RICH_MOBI_[DE]:                                         EDsDsEEEEEDEEqEDEEE 
RICH_fLPS_MOBI_[E]:                                    yEdsdsEEEEEdEEqEdEEE