Q0VAQ4 SMAGP_HUMAN

Gene name: SMAGP
Protein name: Small cell adhesion glycoprotein

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8N434 SVOPL 0.76525
2 Q04771 ACVR1 0.75661 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
3 Q2NKJ3 CTC1 0.74836 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
4 Q9NYN1 RASL12 0.71138 signal transduction GO:0007165
5 Q9H6S1 AZI2 0.70231 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
cell cycle GO:0007049
...
6 Q15760 GPR19 0.70044 signal transduction GO:0007165
7 Q7L099 RUFY3 0.69568 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
8 Q8IWA4 MFN1 0.69568 catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
membrane organization GO:0061024
...
9 P30874 SSTR2 0.68986 anatomical structure development GO:0048856
cell population proliferation GO:0008283
reproduction GO:0000003
...
10 Q68D85 NCR3LG1 0.63132 immune system process GO:0002376

                                           20                  40                  60                  80   
AA:                      MTSLLTTPSPREELMTTPILQPTEALSPEDGASTALIAVVITVVFLTLLSVVILIFFYLYKNKGSYVTYEPTEGEPSAIVQMESDLAKGSEKEEYFI
STMI:                                                        MMMMMMMMMMMMMMMMMMMMM                                        
DO_DISOPRED3:            DDDDDDDDDDDDD..D..DD.....................................................DDDDDDDDDDDD............
DO_IUPRED2A:             .DD...DD.....DDDDDDDDD..D......................................................DDDDD.............
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDD...........                     ................DDDDDDDDDDDD............
CONSENSUS_MOBI:          ....................................                     ........................................
RICH_[PT]:                    TTPsPreelmTTPilqPT                                                                          
RICH_[T]:                 TsllTTpspreelmTTpilqpT                                                                          
RICH_[LP]:                  LLttPsPreeLmttPiLqP                                                                           
RICH_[LT]:                TsLLTTpspreeLmTTpiLqpT