Q13156 RFA4_HUMAN
Gene name: RPA4
Protein name: Replication protein A 30 kDa subunit
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell cycle GO:0007049
- cellular nitrogen compound metabolic process GO:0034641
- DNA metabolic process GO:0006259
- mitotic cell cycle GO:0000278
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q12996 | CSTF3 | 0.61016 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 |
| 2 | Q9Y2D8 | SSX2IP | 0.53522 | cell adhesion GO:0007155 cell cycle GO:0007049 cellular component assembly GO:0022607 ... |
| 3 | Q8IX90 | SKA3 | 0.52772 | cell cycle GO:0007049 cell division GO:0051301 chromosome segregation GO:0007059 ... |
| 4 | Q6PEW0 | PRSS54 | 0.52596 | |
| 5 | Q7Z3Y8 | KRT27 | 0.49669 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 |
| 6 | P02533 | KRT14 | 0.48212 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 7 | Q8TEB7 | RNF128 | 0.47819 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular protein modification process GO:0006464 |
| 8 | Q8N1W2 | ZNF710 | 0.44931 | |
| 9 | Q6NUI1 | CCDC144NL | 0.44165 | |
| 10 | Q16649 | NFIL3 | 0.4259 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 immune system process GO:0002376 |
20 40 60 80 100 AA: MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCNVNQLLSSTVFDPVFKVRGIIVSQVSIVGVIRGAEKASNHICYKIDDMTAK STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................... DO_IUPRED2A: ......................D..D.DDD.D.................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[G]: GfGsyGsisaadGasGG RICH_[S]: SkSgfgSygSiSaadgaSggS RICH_[GS]: SkSGfGSyGSiSaadGaSGGS
120 140 160 180 200 AA: PIEARQWFGREKVKQVTPLSVGVYVKVFGILKCPTGTKSLEVLKIHVLEDMNEFTVHILETVNAHMMLDKARRDTTVESVPVSPSEVNDAGDNDESHRNF STMI: DO_DISOPRED3: .............................................................................DDDDDDDDDDDDDDDDDDD.... DO_IUPRED2A: ..........................................................................DD.DDDDDDDDDDDDDDDDDD..... DO_SPOTD: .......................................................................DDDDDDDDDDDDDDDDDDDDDDDDDD... CONSENSUS: ..........................................................................DDDDDDDDDDDDDDDDDDDDDD.... CONSENSUS_MOBI: ..........................................................................DDDDDDDDDDDDDDDDDDDD...... RICH_[V]: VesVpVspseV RICH_[DV]: VpVspseVnDagDnD RICH_MOBI_[V]: VesVpVspseV RICH_MOBI_[DV]: VpVspseVnDagDnD
220 240 260 AA: IQDEVLRLIHECPHQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD STMI: DO_DISOPRED3: ............................................................. DO_IUPRED2A: ...........................................................DD DO_SPOTD: ...........................................................DD CONSENSUS: ...........................................................DD CONSENSUS_MOBI: .............................................................