Q13526 PIN1_HUMAN
Gene name: PIN1
Protein name: Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cell cycle GO:0007049
- cell death GO:0008219
- cell differentiation GO:0030154
- cell division GO:0051301
- cell junction organization GO:0034330
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- growth GO:0040007
- mitotic cell cycle GO:0000278
- mitotic nuclear division GO:0140014
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9BUN8 | DERL1 | 0.80296 | biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 cellular protein modification process GO:0006464 ... |
| 2 | Q96EZ4 | MYEOV | 0.71286 | |
| 3 | Q8N4K4 | RPRML | 0.70711 | |
| 4 | Q9UNA3 | A4GNT | 0.70711 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cell population proliferation GO:0008283 ... |
| 5 | Q7RTX0 | TAS1R3 | 0.64843 | nervous system process GO:0050877 signal transduction GO:0007165 |
| 6 | Q9H223 | EHD4 | 0.63246 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 protein-containing complex assembly GO:0065003 ... |
| 7 | Q92911 | SLC5A5 | 0.61958 | circulatory system process GO:0003013 transmembrane transport GO:0055085 transport GO:0006810 |
| 8 | Q9UPY5 | SLC7A11 | 0.59708 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 9 | Q8NHA8 | OR1F12 | 0.59367 | signal transduction GO:0007165 |
| 10 | P04629 | NTRK1 | 0.5754 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
20 40 60 80 100 AA: MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGE STMI: DO_DISOPRED3: DDD................................................................................................. DO_IUPRED2A: DDDDDDDDDDDDD....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....DDDDDDDDDDDDD.................... DO_SPOTD: DDDD..................................DDDDDDDDDDDD.................................................. CONSENSUS: DDDD..................................DDDDDDDDDDDD.................................................. CONSENSUS_MOBI: .........................................DDD........................................................ RICH_[G]: GnsssGGknG RICH_[GN]: GNsssGGkNG
120 140 160 AA: EDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE STMI: DO_DISOPRED3: ............................................................... DO_IUPRED2A: ....................DDDDDDDD.......DDDDD....D.................. DO_SPOTD: ............................................................... CONSENSUS: ............................................................... CONSENSUS_MOBI: ...............................................................