Q13541 4EBP1_HUMAN

Gene name: EIF4EBP1
Protein name: Eukaryotic translation initiation factor 4E-binding protein 1

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell cycle GO:0007049
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- mitotic cell cycle GO:0000278
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- signal transduction GO:0007165
- translation GO:0006412

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9HCI5 MAGEE1 0.70638
2 A1L4H1 SSC5D 0.66402 anatomical structure development GO:0048856
immune system process GO:0002376
response to stress GO:0006950
3 Q9HBB8 CDHR5 0.66273 cell adhesion GO:0007155
cell differentiation GO:0030154
cellular component assembly GO:0022607
4 Q13477 MADCAM1 0.65662 cell adhesion GO:0007155
extracellular matrix organization GO:0030198
immune system process GO:0002376
...
5 O43155 FLRT2 0.65528 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
6 Q7Z7G0 ABI3BP 0.63578 cell adhesion GO:0007155
extracellular matrix organization GO:0030198
7 Q6UXF1 TMEM108 0.63512 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell junction organization GO:0034330
...
8 A1A4S6 ARHGAP10 0.62042 cell death GO:0008219
cytoskeleton organization GO:0007010
signal transduction GO:0007165
9 Q06455 RUNX1T1 0.62025 biosynthetic process GO:0009058
cell differentiation GO:0030154
cellular nitrogen compound metabolic process GO:0034641
10 Q6ZS17 RIPOR1 0.61812 protein transport GO:0015031
response to stress GO:0006950
signal transduction GO:0007165
...

                                           20                  40                  60                  80                 100
AA:                      MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRN
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDD..DD.D..DDDDDDDDDD.D.........................................DDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....DDDD....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDD................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[PS]:                                                                                                 SPSSdePPmeaSqShlrn
RICH_[PT]:                                                                                PvTkTPPrdlPTiPgvTsP                
RICH_[P]:                                                                                 PvtktPPrdlPtiPgvtsP                
RICH_[S]:                                                                                                  SpSSdeppmeaSqShlrn
RICH_[T]:                                                                                   TkTpprdlpTipgvT                  
RICH_[GT]:                                              GdysTTpGGT                                                           
RICH_MOBI_[PT]:                                                                           PvTkTPPrdlPTiPgvTsP                
RICH_MOBI_[RV]:                      RaipatRRVV                                                                              
RICH_MOBI_[P]:                                                                            PvtktPPrdlPtiPgvtsP                
RICH_MOBI_[T]:                                              TTpggTlfsTTpggT                 TkTpprdlpTipgvT                  
RICH_MOBI_[FG]:                                                GGtlFsttpGGtriiydrkF                                          
RICH_MOBI_[FI]:                                                    FsttpggtrIIydrkF                                          
RICH_MOBI_[FT]:                                                  TlFsTTpggTriiydrkF                                          
RICH_MOBI_[GI]:                                                GGtlfsttpGGtrII                                               
RICH_MOBI_[GT]:                                   GvqlppGdysTTpGGTlfsT                                                       
RICH_MOBI_[IT]:                                             TTpggTlfsTTpggTrII                                               
RICH_fLPS_MOBI_[T]:                                    pgdysTTpggTlfsTTpggT                                                  

                           
AA:                      SPEDKRAGGEESQFEMDI
STMI:                                      
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDD
RICH_[PS]:               SP                
RICH_[S]:                S