Q13637 RAB32_HUMAN
Gene name: RAB32
Protein name: Ras-related protein Rab-32
List of terms from Generic GO subset, which this protein is a part of:
- cell differentiation GO:0030154
- cellular component assembly GO:0022607
- developmental maturation GO:0021700
- immune system process GO:0002376
- protein transport GO:0015031
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q14657 | LAGE3 | 0.82796 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 2 | Q9H832 | UBE2Z | 0.81971 | catabolic process GO:0009056 cell death GO:0008219 cellular protein modification process GO:0006464 |
| 3 | Q9UMF0 | ICAM5 | 0.81449 | cell adhesion GO:0007155 extracellular matrix organization GO:0030198 immune system process GO:0002376 ... |
| 4 | Q12962 | TAF10 | 0.79135 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 5 | P14061 | HSD17B1 | 0.78896 | biosynthetic process GO:0009058 |
| 6 | Q96C90 | PPP1R14B | 0.78575 | immune system process GO:0002376 response to stress GO:0006950 |
| 7 | Q6Y1H2 | HACD2 | 0.78324 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 8 | Q5GH72 | XKR7 | 0.77971 | anatomical structure development GO:0048856 cell death GO:0008219 membrane organization GO:0061024 ... |
| 9 | Q14103 | HNRNPD | 0.77879 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 10 | P50991 | CCT4 | 0.77558 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 ... |
20 40 60 80 100 AA: MAGGGAGDPGLGAAAAPAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEAV STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDD.................................................................................. DO_IUPRED2A: ...........DDD...................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDD................................................................................ CONSENSUS: DDDDDDDDDDDDDDDDDD.................................................................................. CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDD................................................................................. RICH_[AG]: AGGGAGdpGlGAAAApA RICH_[A]: AgggAgdpglgAAAApA RICH_[G]: GGGaGdpGlG RICH_fLPS_[A]: AgggAgdpglgAAAA RICH_fLPS_[G]: maGGGaGdpGlGaaa RICH_fLPS_[GA]: mAGGGAGdpGlGAAAApA RICH_MOBI_[AG]: AGGGAGdpGlGAAAApA RICH_MOBI_[A]: AgggAgdpglgAAAApA RICH_MOBI_[G]: GGGaGdpGlG RICH_fLPS_MOBI_[A]: AgggAgdpglgAAAApA RICH_fLPS_MOBI_[AG]: mAGGGAGdpGlGAAAApA RICH_fLPS_MOBI_[G]: maGGGaGdpGlGaaa
120 140 160 180 200 AA: GAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFP STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .......................................................D............................................ DO_SPOTD: ...................................................................................................D CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ...................................................................................................D
220 AA: NEENDVDKIKLDQETLRAENKSQCC STMI: DO_DISOPRED3: ....DDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ...DDDD..DDDD............ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDD... CONSENSUS: ...DDDDDDDDDDDDDDDDDDD... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDD