Q13794 APR_HUMAN

Gene name: PMAIP1
Protein name: Phorbol-12-myristate-13-acetate-induced protein 1

List of terms from Generic GO subset, which this protein is a part of:
- carbohydrate metabolic process GO:0005975
- catabolic process GO:0009056
- cell death GO:0008219
- homeostatic process GO:0042592
- immune system process GO:0002376
- membrane organization GO:0061024
- protein transport GO:0015031
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40      
AA:                      MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
STMI:                                                                          
DO_DISOPRED3:            DDDDDDDDDDDDDDDD.....................................D
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDD..D.................................
DO_SPOTD:                DDDDDDDDDDDDDDDDD...................................DD
CONSENSUS:               DDDDDDDDDDDDDDDDD....................................D
CONSENSUS_MOBI:          ...........................................D..........