Q13901 C1D_HUMAN

Gene name: C1D
Protein name: Nuclear nucleic acid-binding protein C1D

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell death GO:0008219
- cellular nitrogen compound metabolic process GO:0034641
- ribosome biogenesis GO:0042254

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q92616 GCN1 0.70711 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
response to stress GO:0006950
2 O95140 MFN2 0.5547 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
catabolic process GO:0009056
...
3 Q9NWL6 ASNSD1 0.53916 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281
4 Q6UWP7 LCLAT1 0.50252 anatomical structure development GO:0048856
biosynthetic process GO:0009058
5 Q9BV44 THUMPD3 0.49719 cellular nitrogen compound metabolic process GO:0034641
6 P26715 KLRC1 0.49581 immune system process GO:0002376
signal transduction GO:0007165
7 Q8N6Q8 METTL25 0.49375
8 Q8IUN9 CLEC10A 0.48507 immune system process GO:0002376
response to stress GO:0006950
signal transduction GO:0007165
...
9 Q13740 ALCAM 0.45296 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
10 P25929 NPY1R 0.44182 anatomical structure development GO:0048856
carbohydrate metabolic process GO:0005975
circulatory system process GO:0003013
...

                                           20                  40                  60                  80                 100
AA:                      MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEI
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDD.............................................................................................
DO_IUPRED2A:             ................................................................................DD..................
DO_SPOTD:                DDDDDDD.............................................................................................
CONSENSUS:               DDDDDDD.............................................................................................
CONSENSUS_MOBI:          ....................................................................................................

                                          120                 140                   
AA:                      TDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSKS
STMI:                                                             
DO_DISOPRED3:            .............................DDDDDDDDDDDD
DO_IUPRED2A:             ....DD.....................DDDDDDDDDDDDDD
DO_SPOTD:                .......................DDDDDDDDDDDDDDDDDD
CONSENSUS:               ...........................DDDDDDDDDDDDDD
CONSENSUS_MOBI:          .........................................
RICH_[KN]:                                          KNasKvaNKgK