Q13938 CAYP1_HUMAN
Gene name: CAPS
Protein name: Calcyphosin
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9H0E7 | USP44 | 0.91954 | catabolic process GO:0009056 cell cycle GO:0007049 cell division GO:0051301 ... |
| 2 | Q8IZ26 | ZNF34 | 0.90462 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 3 | Q96L93 | KIF16B | 0.86204 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 catabolic process GO:0009056 ... |
| 4 | Q9NZQ9 | TMOD4 | 0.84921 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 5 | O75095 | MEGF6 | 0.8245 | |
| 6 | P42229 | STAT5A | 0.74397 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell population proliferation GO:0008283 ... |
| 7 | Q6ZV89 | SH2D5 | 0.73601 | |
| 8 | P49005 | POLD2 | 0.73321 | biosynthetic process GO:0009058 cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ... |
| 9 | P14735 | IDE | 0.72374 | anatomical structure development GO:0048856 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | Q15916 | ZBTB6 | 0.71164 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 immune system process GO:0002376 |
20 40 60 80 100 AA: MDAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWDRNGSGTLDLEEFLRALRPPMSQAREAVIAA STMI: DO_DISOPRED3: D................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DD.................................................................................................. CONSENSUS: D................................................................................................... CONSENSUS_MOBI: ..........................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDD.............. RICH_MOBI_[L]: LdLeefLraL
120 140 160 180 AA: AFAKLDRSGDGVVTVDDLRGVYSGRAHPKVRSGEWTEDEVLRRFLDNFDSSEKDGQVTLAEFQDYYSGVSASMNTDEEFVAMMTSAWQL STMI: DO_DISOPRED3: ......................................................................................... DO_IUPRED2A: ............................D...D........................................................ DO_SPOTD: ......................................................................................... CONSENSUS: ......................................................................................... CONSENSUS_MOBI: .....DD..................................................................................