List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell population proliferation GO:0008283
- cellular component assembly GO:0022607
- generation of precursor metabolites and energy GO:0006091
- protein-containing complex assembly GO:0065003
- transmembrane transport GO:0055085
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40                  60                 
AA:                      MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI
STMI:                                                                                   
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDD.......................................
DO_IUPRED2A:             DDDDDDDDDDDDD..................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDD............................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDD............................................
CONSENSUS_MOBI:          ...............................................................