Q14602 ID2B_HUMAN
Gene name: ID2B
Protein name: Putative DNA-binding protein inhibitor ID-2B
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
20 AA: MKAFSPVRSIRKNSLLDHRLGISQSKTPVDDLMSLL STMI: DO_DISOPRED3: D................................... DO_IUPRED2A: .................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: D................................... CONSENSUS_MOBI: ....................................