Q14691 PSF1_HUMAN
Gene name: GINS1
Protein name: DNA replication complex GINS protein PSF1
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8N136 | DAW1 | 0.7697 | |
| 2 | Q8N1F7 | NUP93 | 0.70306 | biological process involved in symbiotic interaction GO:0044403 carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 ... |
| 3 | Q92621 | NUP205 | 0.65965 | biological process involved in symbiotic interaction GO:0044403 carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 ... |
| 4 | Q9NSP4 | CENPM | 0.64245 | |
| 5 | P14778 | IL1R1 | 0.64245 | immune system process GO:0002376 response to stress GO:0006950 signal transduction GO:0007165 |
| 6 | O94822 | LTN1 | 0.6182 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 7 | Q3MIT2 | PUS10 | 0.60416 | cellular nitrogen compound metabolic process GO:0034641 |
| 8 | Q9H0E7 | USP44 | 0.59076 | catabolic process GO:0009056 cell cycle GO:0007049 cell division GO:0051301 ... |
| 9 | Q8IZ26 | ZNF34 | 0.58117 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 10 | P61011 | SRP54 | 0.58078 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular component assembly GO:0022607 ... |
20 40 60 80 100 AA: MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSVLPN STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: ...........................................DD.D..DDDD............................................... DO_SPOTD: ...............................................DDDDDDDD............................................. CONSENSUS: .................................................DDDD............................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 AA: ALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEHILS STMI: DO_DISOPRED3: ................................................................................................ DO_IUPRED2A: ..................................D............................................................. DO_SPOTD: ................................................................................................ CONSENSUS: ................................................................................................ CONSENSUS_MOBI: .............................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD RICH_MOBI_[L]: LLkknsqhfLprwkceqL RICH_MOBI_[Y]: YievrclkdY RICH_MOBI_[IL]: LprwkceqLIrqgvLehIL