Q15185 TEBP_HUMAN

Gene name: PTGES3
Protein name: Prostaglandin E synthase 3

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- chromosome organization GO:0051276
- DNA metabolic process GO:0006259
- homeostatic process GO:0042592
- protein folding GO:0006457
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- ribonucleoprotein complex assembly GO:0022618
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q6ZNG9 KRBA2 0.67615 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
DNA metabolic process GO:0006259
2 Q9BXN1 ASPN 0.63917 anatomical structure development GO:0048856
signal transduction GO:0007165
3 Q16623 STX1A 0.61824 cell-cell signaling GO:0007267
cellular component assembly GO:0022607
cellular protein modification process GO:0006464
...
4 E9PB15 PTGES3L 0.61657 cellular component assembly GO:0022607
protein folding GO:0006457
protein-containing complex assembly GO:0065003
5 Q15139 PRKD1 0.60924 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
6 Q86VP6 CAND1 0.57807 biosynthetic process GO:0009058
cell differentiation GO:0030154
cellular component assembly GO:0022607
...
7 O14958 CASQ2 0.57554 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
8 P49746 THBS3 0.55441 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...
9 Q92882 OSTF1 0.55367 immune system process GO:0002376
signal transduction GO:0007165
transport GO:0006810
...
10 Q15029 EFTUD2 0.55342 cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397

                                           20                  40                  60                  80                 100
AA:                      MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLS
STMI:                                                                                                                        
DO_DISOPRED3:            ....................................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DD..................................................................................................
CONSENSUS:               ....................................................................................................
CONSENSUS_MOBI:          ....................................................................................................

                                          120                 140
AA:                      VDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
STMI:                                                                                
DO_DISOPRED3:            ........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             .................DDDDDDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                .........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               .........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[D]:                          DDsDeDmsnfD           DeDvDlpevDgaDDDsqDsDDekmpD  
RICH_[M]:                                MsnfdrfseMMnnM                              
RICH_[DF]:                         DDsDeDmsnFDrF                                     
RICH_[DM]:                         DDsDeDMsnfDrfseMMnnM                              
RICH_[DN]:                                          NNmggDeDvD                       
RICH_[FM]:                               MsnFdrFseMMnnM                              
RICH_[FN]:                                 NFdrFsemmNN                               
RICH_[MN]:                               MsNfdrfseMMNNM                              
RICH_fLPS_[D]:                    eDDsDeDmsnfDrfs        DeDvDlpevDgaDDDsqDsDDekmpD  
RICH_fLPS_[MD]:                   eDDsDeDMsnfDrfseMMnnMggDeDvDlpevDgaDDDsqDsDDekMpD  
RICH_fLPS_[M]:                     ddsdedMsnfdrfseMMnnM                              
RICH_MOBI_[D]:                                           DeDvDlpevDgaDDDsqDsDDekmpD  
RICH_MOBI_[DM]:                                   MMnnMggDeDvDlpevDgaDD              
RICH_MOBI_[DN]:                                     NNmggDeDvD                       
RICH_MOBI_[DV]:                                          DeDVDlpeVDgaD               
RICH_fLPS_MOBI_[D]:                                      DeDvDlpevDgaDDDsqDsDDekmpD  
RICH_fLPS_MOBI_[DM]:                              MMnnMggDeDvDlpevDgaDDDsqDsDDekMpD  
RICH_fLPS_MOBI_[M]:                               MMnnMggdedvdlpe