Q15546 PAQRB_HUMAN
Gene name: MMD
Protein name: Monocyte to macrophage differentiation factor
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- cellular protein modification process GO:0006464
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9UN67 | PCDHB10 | 0.81557 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell junction organization GO:0034330 ... |
| 2 | Q9Y5F2 | PCDHB11 | 0.61546 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell junction organization GO:0034330 ... |
| 3 | Q9Y5E5 | PCDHB4 | 0.57735 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell junction organization GO:0034330 ... |
| 4 | Q9ULC5 | ACSL5 | 0.57735 | biosynthetic process GO:0009058 cell death GO:0008219 cellular nitrogen compound metabolic process GO:0034641 ... |
| 5 | Q9UBS3 | DNAJB9 | 0.43068 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
| 6 | Q6V9R5 | ZNF562 | 0.41425 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 7 | Q9Y5F1 | PCDHB12 | 0.40825 | anatomical structure development GO:0048856 cell adhesion GO:0007155 |
| 8 | Q9NPC3 | CCNB1IP1 | 0.39952 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell cycle GO:0007049 ... |
| 9 | Q9NZI5 | GRHL1 | 0.39324 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 10 | Q16820 | MEP1B | 0.36961 | response to stress GO:0006950 transport GO:0006810 |
20 40 60 80 100 AA: MRFKNRFQRFMNHRAPANGRYKPTCYEHAANCYTHAFLIVPAIVGSALLHRLSDDCWEKITAWIYGMGLCALFIVSTVFHIVSWKKSHLRTVEHCFHMCD STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDD...................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDD................................................................................. CONSENSUS: DDDDDDDDDDDDDD.............. ............ .................. CONSENSUS_MOBI: ............................ ............ .................. RICH_[FN]: FkNrFqrFmN RICH_[NR]: NRfqRfmNhR RICH_fLPS_[F]: mrFknrFqrF
120 140 160 180 200 AA: RMVIYFFIAASYAPWLNLRELGPLASHMRWFIWLMAAGGTIYVFLYHEKYKVVELFFYLTMGFSPALVVTSMNNTDGLQELACGGLIYCLGVVFFKSDGI STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: . .. ...... .. ... CONSENSUS_MOBI: . .. ...... .. ...
220 AA: IPFAHAIWHLFVATAAAVHYYAIWKYLYRSPTDFMRHL STMI: MMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ....................................DD DO_IUPRED2A: ...................................... DO_SPOTD: ................................DDDDDD CONSENSUS: .................DD CONSENSUS_MOBI: ...................