Q15546 PAQRB_HUMAN

Gene name: MMD
Protein name: Monocyte to macrophage differentiation factor

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- cellular protein modification process GO:0006464

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9UN67 PCDHB10 0.81557 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell junction organization GO:0034330
...
2 Q9Y5F2 PCDHB11 0.61546 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell junction organization GO:0034330
...
3 Q9Y5E5 PCDHB4 0.57735 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell junction organization GO:0034330
...
4 Q9ULC5 ACSL5 0.57735 biosynthetic process GO:0009058
cell death GO:0008219
cellular nitrogen compound metabolic process GO:0034641
...
5 Q9UBS3 DNAJB9 0.43068 anatomical structure development GO:0048856
catabolic process GO:0009056
cell differentiation GO:0030154
...
6 Q6V9R5 ZNF562 0.41425 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
7 Q9Y5F1 PCDHB12 0.40825 anatomical structure development GO:0048856
cell adhesion GO:0007155
8 Q9NPC3 CCNB1IP1 0.39952 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell cycle GO:0007049
...
9 Q9NZI5 GRHL1 0.39324 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
10 Q16820 MEP1B 0.36961 response to stress GO:0006950
transport GO:0006810

                                           20                  40                  60                  80                 100
AA:                      MRFKNRFQRFMNHRAPANGRYKPTCYEHAANCYTHAFLIVPAIVGSALLHRLSDDCWEKITAWIYGMGLCALFIVSTVFHIVSWKKSHLRTVEHCFHMCD
STMI:                                                MMMMMMMMMMMMMMMMMMMMM            MMMMMMMMMMMMMMMMMMMMM                  
DO_DISOPRED3:            DDDDDDDDDDDDDD......................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDD.................................................................................
CONSENSUS:               DDDDDDDDDDDDDD..............                     ............                     ..................
CONSENSUS_MOBI:          ............................                     ............                     ..................
RICH_[FN]:                 FkNrFqrFmN                                                                                        
RICH_[NR]:                   NRfqRfmNhR                                                                                      
RICH_fLPS_[F]:           mrFknrFqrF                                                                                          

                                          120                 140                 160                 180                 200
AA:                      RMVIYFFIAASYAPWLNLRELGPLASHMRWFIWLMAAGGTIYVFLYHEKYKVVELFFYLTMGFSPALVVTSMNNTDGLQELACGGLIYCLGVVFFKSDGI
STMI:                     MMMMMMMMMMMMMMMMMMMMM  MMMMMMMMMMMMMMMMMMMMM      MMMMMMMMMMMMMMMMMMMMM  MMMMMMMMMMMMMMMMMMMMM   MM
DO_DISOPRED3:            ....................................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                ....................................................................................................
CONSENSUS:               .                     ..                     ......                     ..                     ...  
CONSENSUS_MOBI:          .                     ..                     ......                     ..                     ...  

                                          220  
AA:                      IPFAHAIWHLFVATAAAVHYYAIWKYLYRSPTDFMRHL
STMI:                    MMMMMMMMMMMMMMMMMMM                   
DO_DISOPRED3:            ....................................DD
DO_IUPRED2A:             ......................................
DO_SPOTD:                ................................DDDDDD
CONSENSUS:                                  .................DD
CONSENSUS_MOBI:                             ...................