Q15649 ZNHI3_HUMAN
Gene name: ZNHIT3
Protein name: Zinc finger HIT domain-containing protein 3
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- protein-containing complex assembly GO:0065003
- ribonucleoprotein complex assembly GO:0022618
- ribosome biogenesis GO:0042254
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q6P2S7 | TTC41P | 0.91756 | |
2 | P78348 | ASIC1 | 0.89443 |
cell-cell signaling
GO:0007267 cellular component assembly GO:0022607 nervous system process GO:0050877 ... |
3 | Q6ZU15 | SEPTIN14 | 0.88492 |
cell cycle
GO:0007049 cell division GO:0051301 |
4 | Q86V20 | SHLD2 | 0.88492 |
anatomical structure development
GO:0048856 cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 ... |
5 | Q5FWF6 | ZNF789 | 0.87416 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
6 | Q5JPI3 | C3orf38 | 0.86193 |
cell death
GO:0008219 |
7 | Q8TCF1 | ZFAND1 | 0.86193 |
protein transport
GO:0015031 transport GO:0006810 |
8 | Q9NV72 | ZNF701 | 0.85838 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
9 | O43852 | CALU | 0.85328 |
cellular protein modification process
GO:0006464 |
10 | P21246 | PTN | 0.8403 |
anatomical structure development
GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
20 40 60 80 100
AA: MASLKCSTVVCVICLEKPKYRCPACRVPYCSVVCFRKHKEQCNPETRPVEKKIRSALPTKTVKPVENKDDDDSIADFLNSDEEEDRVSLQNLKNLGESAT
STMI:
DO_DISOPRED3: DDDDD...............................................................................................
DO_IUPRED2A: .............................................D..DD..DD.DDD.DDDDDDD......DDDDDD.........DDD..........
DO_SPOTD: DDDDDD................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............
CONSENSUS: DDDDD........................................DDDDDDDDDDDDDDDDDDDDD......DDDDDD......................
CONSENSUS_MOBI: ....................................................................................................
RICH_[K]: KKirsalptKtvK
120 140
AA: LRSLLLNPHLRQLMVNLDQGEDKAKLMRAYMQEPLFVEFADCCLGIVEPSQNEES
STMI:
DO_DISOPRED3: .................................................DDDDDD
DO_IUPRED2A: .......................D............................DDD
DO_SPOTD: .................................................DDDDDD
CONSENSUS: .................................................DDDDDD
CONSENSUS_MOBI: .......................................................