Q15651 HMGN3_HUMAN

Gene name: HMGN3
Protein name: High mobility group nucleosome-binding domain-containing protein 3

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- chromosome organization GO:0051276
- homeostatic process GO:0042592
- protein transport GO:0015031
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O00294 TULP1 0.86477 anatomical structure development GO:0048856
cell differentiation GO:0030154
homeostatic process GO:0042592
...
2 Q9NX58 LYAR 0.82742 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
3 Q5T3I0 GPATCH4 0.786
4 P29536 LMOD1 0.78071 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
5 Q9C093 SPEF2 0.77682 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular component assembly GO:0022607
...
6 O95995 GAS8 0.77577 anatomical structure development GO:0048856
cell population proliferation GO:0008283
cellular component assembly GO:0022607
...
7 Q8N436 CPXM2 0.76708 cellular nitrogen compound metabolic process GO:0034641
protein maturation GO:0051604
8 Q8IYW2 CFAP46 0.76676 cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
9 Q6FHJ7 SFRP4 0.76499 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell death GO:0008219
...
10 Q9UQ13 SHOC2 0.76169 signal transduction GO:0007165

                                           20                  40                  60                  80 
AA:                      MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQEAGKEGTAPSENGETKAEEAQKTESVDNEGE
STMI:                                                                                                                       
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[PR]:                                       RRsaRlsakPaPPkPePkPR                                                       
RICH_[AE]:                                                                                   EAgkEgtApsEngEtkAEEA           
RICH_[E]:                                                                                EEkqEagkEgtapsEngE   EEaqktEsvdnEgE
RICH_[K]:                  KrKspentegKdgsKvtK            KpappKpepKprKtsaKKepgaKisrgaKgKKeeKqeagK                           
RICH_[P]:                                      PtrrsarlsakPaPPkPePkPrktsakkeP                                               
RICH_[R]:                                        RRsaRlsakpappkpepkpR                                                       
RICH_[EG]:                                                                         GakGkkEEkqEaGkEG                         
RICH_[EK]:                                                                KEpgaKisrgaKgKKEEKqEagKE                          
RICH_[GK]:                                                                   GaKisrGaKGKKeeKqeaGK                           
RICH_[KP]:                                               KPaPPKPePKPrKtsaKKePgaK                                            
RICH_fLPS_[P]:                                            PaPPkPePkP                                                        
RICH_fLPS_[K]:                                           KpappKpepKprKtsaKKepgaKisrgaKgKKeeKqeagK                           
RICH_MOBI_[PR]:                                  RRsaRlsakPaPPkPePkPR                                                       
RICH_MOBI_[AE]:                                                                              EAgkEgtApsEngEtkAEEA           
RICH_MOBI_[E]:                                                                           EEkqEagkEgtapsEngE   EEaqktEsvdnEgE
RICH_MOBI_[K]:             KrKspentegKdgsKvtK            KpappKpepKprKtsaKKepgaKisrgaKgKKeeKqeagK                           
RICH_MOBI_[P]:                                 PtrrsarlsakPaPPkPePkPrktsakkeP                                               
RICH_MOBI_[R]:                                   RRsaRlsakpappkpepkpR                                                       
RICH_MOBI_[EG]:                                                                    GakGkkEEkqEaGkEG                         
RICH_MOBI_[EK]:                                                           KEpgaKisrgaKgKKEEKqEagKE                          
RICH_MOBI_[GK]:                                                              GaKisrGaKGKKeeKqeaGK                           
RICH_MOBI_[KP]:                                          KPaPPKPePKPrKtsaKKePgaK                                            
RICH_fLPS_MOBI_[P]:                                       PaPPkPePkP                                                        
RICH_fLPS_MOBI_[K]:                                      KpappKpepKprKtsaKKepgaKisrgaKgKKeeKqeagK