List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell adhesion GO:0007155
- cell differentiation GO:0030154
- cell morphogenesis GO:0000902
- cellular component assembly GO:0022607
- immune system process GO:0002376
- membrane organization GO:0061024
- protein transport GO:0015031
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40                  60                  80
AA:                      MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWAIGITVLVIFIIIIIVWVVSS
STMI:                                                                                                 MMMMMMMMMMMMMMMMMMMMM  
DO_DISOPRED3:            DDDDDDDDDDDDDDDD.D.DD.............................................................DDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDD.....................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDD.................................................................D.DDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDD..............................................................                     DD
CONSENSUS_MOBI:          .............................................................................                     ..