Q16520 BATF_HUMAN

Gene name: BATF
Protein name: Basic leucine zipper transcriptional factor ATF-like

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell differentiation GO:0030154
- cellular nitrogen compound metabolic process GO:0034641
- DNA metabolic process GO:0006259
- immune system process GO:0002376
- response to stress GO:0006950
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P51957 NEK4 0.71872 biosynthetic process GO:0009058
cell cycle GO:0007049
cell division GO:0051301
...
2 Q9BSF8 BTBD10 0.69777 cell death GO:0008219
cell population proliferation GO:0008283
3 Q38SD2 LRRK1 0.66377 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell-cell signaling GO:0007267
...
4 Q8WVZ9 KBTBD7 0.65808 cellular protein modification process GO:0006464
signal transduction GO:0007165
5 Q96HP0 DOCK6 0.65299 response to stress GO:0006950
signal transduction GO:0007165
6 Q9BZ72 PITPNM2 0.64655 biosynthetic process GO:0009058
signal transduction GO:0007165
7 Q9H8M9 EVA1A 0.62921 catabolic process GO:0009056
cell death GO:0008219
cellular protein modification process GO:0006464
8 Q9BZB8 CPEB1 0.62871 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
...
9 P52757 CHN2 0.62485 signal transduction GO:0007165
10 Q8TC71 SPATA18 0.62299 catabolic process GO:0009056
response to stress GO:0006950

                                           20                  40                  60                  80                 100
AA:                      MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAAST
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDD.D........................................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................DDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDD.....................................................DDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................................................DDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................................
RICH_[PS]:                PhSSdSSdSSfSrSPPP                                                                                  
RICH_[AP]:                                                                                                               AAst
RICH_[D]:                     DssDssfsrspppgkqDssDD                                                                          
RICH_[R]:                             RspppgkqdssddvRRvqRReknR                                                               
RICH_[S]:                   SSdSSdSSfSrSpppgkqdSS                                                                            
RICH_[DS]:                    DSSDSSfSrSpppgkqDSSDD                                                                          
RICH_fLPS_[R]:                                      RRvqRReknR                                                               
RICH_fLPS_[S]:           mphSSdSSdSSfSrSpppgkqdSS                                                                            
RICH_MOBI_[QR]:                                     RRvQRReknRiaaQksRQRQtQ                                                   
RICH_MOBI_[D]:                DssDssfsrspppgkqDssDD                                                                          
RICH_MOBI_[Q]:                                         QrreknriaaQksrQrQtQ                                                   
RICH_MOBI_[R]:                        RspppgkqdssddvRRvqRReknRiaaqksRqR                                                      
RICH_MOBI_[S]:              SSdSSdSSfSrSpppgkqdSS                                                                            
RICH_MOBI_[DS]:               DSSDSSfSrSpppgkqDSSDD                                                                          
RICH_fLPS_MOBI_[R]:                                vRRvqRReknRiaaqksRqR                                                      
RICH_fLPS_MOBI_[S]:      mphSSdSSdSSfSrSpppgkqdSS                                                                            

                                          120               
AA:                      PSPPEVVYSAHAFHQPHVSSPRFQP
STMI:                                             
DO_DISOPRED3:            .DDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             D..DDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .........................
RICH_[AP]:               PsPPevvysAhAfhqP         
RICH_[FH]:                         HaFHqpHvssprF  
RICH_[HV]:                    VVysaHafHqpHV