Q16559 TAL2_HUMAN

Gene name: TAL2
Protein name: T-cell acute lymphocytic leukemia protein 2

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- growth GO:0040007

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q86XS8 RNF130 0.68679 catabolic process GO:0009056
cell death GO:0008219
2 P42785 PRCP 0.63654 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
circulatory system process GO:0003013
...
3 Q6ZWC4 n/a 0.61338
4 Q8IZJ1 UNC5B 0.53231 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell death GO:0008219
...
5 O75333 TBX10 0.50194 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
6 O14638 ENPP3 0.48443 biosynthetic process GO:0009058
catabolic process GO:0009056
cell population proliferation GO:0008283
...
7 Q16678 CYP1B1 0.47729 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
8 Q9BZE0 GLIS2 0.46698 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
9 Q7Z4S9 SH2D6 0.46391 signal transduction GO:0007165
10 Q5BKY1 LRRC10 0.4621 anatomical structure development GO:0048856
cell differentiation GO:0030154

                                           20                  40                  60                  80                 100
AA:                      MTRKIFTNTRERWRQQNVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVLGEQSLQQTGVAAQGNILGLFPQGPHLPGLEDRTLLENYQVPS
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDD..................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DD...DD.DDD.....D......DDDD.D.DDDDDDDDDDDD......................................D.......DDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDD....................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDD.....................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ........................................................................................DDDDDDDDDDDD
RICH_[L]:                                                                                          LgLfpqgphLpgLedrtLL       
RICH_[GL]:                                                                                      GniLGLfpqGphLpGL             
RICH_[HP]:                                                                                                                 Ps
RICH_[LP]:                                                                                                PhLPgLedrtLLenyqvPs
RICH_MOBI_[HP]:                                                                                                            Ps

                                     
AA:                      PGPSHHIP
STMI:                            
DO_DISOPRED3:            DDDDDDDD
DO_IUPRED2A:             DDDDDDDD
DO_SPOTD:                DDDDDDDD
CONSENSUS:               DDDDDDDD
CONSENSUS_MOBI:          DDDDDDDD
RICH_[HP]:               PgPsHHiP
RICH_[LP]:               P       
RICH_MOBI_[HP]:          PgPsHHiP