Q1A5X6 IQCJ_HUMAN
Gene name: IQCJ
Protein name: IQ domain-containing protein J
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q01113 | IL9R | 0.86974 | cell population proliferation GO:0008283 signal transduction GO:0007165 |
| 2 | Q17RH7 | TPRXL | 0.86488 | |
| 3 | Q5SVZ6 | ZMYM1 | 0.85682 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell morphogenesis GO:0000902 ... |
| 4 | O43462 | MBTPS2 | 0.84939 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 5 | Q96CX6 | LRRC58 | 0.84221 | signal transduction GO:0007165 |
| 6 | Q9H4H8 | FAM83D | 0.83663 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell cycle GO:0007049 ... |
| 7 | Q495N2 | SLC36A3 | 0.83237 | transmembrane transport GO:0055085 transport GO:0006810 |
| 8 | Q86W28 | NLRP8 | 0.81555 | |
| 9 | Q9NXV6 | CDKN2AIP | 0.81034 | growth GO:0040007 response to stress GO:0006950 signal transduction GO:0007165 |
| 10 | Q9UGV2 | NDRG3 | 0.80982 | cell differentiation GO:0030154 growth GO:0040007 reproduction GO:0000003 ... |
20 40 60 80 100 AA: MRLEELKRLQNPLEQVNDGKYSFENHQLAMDAENNIEKYPLNLQPLESKVKIIQRAWREYLQRQEPLGKRSPSPPSVSSEKLSSSVSMNTFSDSSTPFAR STMI: DO_DISOPRED3: D...................................................................DDDDDDDDDDD..................... DO_IUPRED2A: .D..D.DDDDDD.DDDDDDDDD.DD.DD.....DD............................DDDDDDDDDDDDDDDDDDDDDD.D..........D.. DO_SPOTD: DDDDDDDDDDDDDDDDDDDD.............................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD. CONSENSUS: DDDDDDDDDDDDDDDDDDDD.............................................DDDDDDDDDDDDDDDDDDDDDD..........D.. CONSENSUS_MOBI: ..............................................................DDDDDDDDDDDDDDDDDDDDDDDDDD............ RICH_[PS]: PlgkrSPSPPSvSSeklSSS RICH_[S]: SpSppSvSSeklSSSvS RICH_fLPS_[S]: SpSppSvSSeklSSS RICH_MOBI_[S]: SpSppSvSSeklSSSvS RICH_MOBI_[SV]: VSSeklSSSV RICH_fLPS_MOBI_[S]: SpSppSvSSeklSSS
120 140 AA: APVGKIHPYISWRLQSPGDKLPGGRKVILLYLDQLARPTGFIHTLKEPQIERLGFLTLQ STMI: DO_DISOPRED3: ........................................................... DO_IUPRED2A: ........................................................... DO_SPOTD: ........................................................... CONSENSUS: ........................................................... CONSENSUS_MOBI: ...........................................................