Q30KQ9 DB110_HUMAN

Gene name: DEFB110
Protein name: Beta-defensin 110

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40                  60             
AA:                      MKIQLFFFILHFWVTILPAKKKYPEYGSLDLRRECRIGNGQCKNQCHENEIRIAYCIRPGTHCCLQQ
STMI:                    SSSSSSSSSSSSSSSSSSS                                                
DO_DISOPRED3:            D..................................................................
DO_IUPRED2A:             ...................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDD..............................................
CONSENSUS:                                  ................................................
CONSENSUS_MOBI:                             ................................................