Q3ZAQ7 VMA21_HUMAN

Gene name: VMA21
Protein name: Vacuolar ATPase assembly integral membrane protein VMA21

List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- protein-containing complex assembly GO:0065003

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40                  60                  80                 100
AA:                      MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKSYIFEGALGMSNRDSYFYAAIVAVVAVHVVLALFVYVAWNEGSRQWREGKQ
STMI:                                             MMMMMMMMMMMMMMMMMMMMM                   MMMMMMMMMMMMMMMMMMMMM              
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDD...........................................................................DDDDD
DO_IUPRED2A:             .................................................................................................DDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDD......................................................................DDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDD.....                     ...................                     .........DDDDD
CONSENSUS_MOBI:          .........................                     ...................                     ..............

                                            
AA:                      D
STMI:                     
DO_DISOPRED3:            D
DO_IUPRED2A:             D
DO_SPOTD:                D
CONSENSUS:               D
CONSENSUS_MOBI:          .