Q3ZCQ2 AX2R_HUMAN
Gene name: ANXA2R
Protein name: Annexin-2 receptor
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8NFK1 | GJC3 | 0.7496 | anatomical structure development GO:0048856 cell-cell signaling GO:0007267 nervous system process GO:0050877 |
| 2 | A6NLW8 | DUXA | 0.72059 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 3 | Q92637 | FCGR1B | 0.66867 | immune system process GO:0002376 response to stress GO:0006950 signal transduction GO:0007165 ... |
| 4 | Q96FL8 | SLC47A1 | 0.66742 | transmembrane transport GO:0055085 transport GO:0006810 |
| 5 | Q9BV73 | CEP250 | 0.64491 | cell cycle GO:0007049 cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 ... |
| 6 | P12314 | FCGR1A | 0.64407 | cellular protein modification process GO:0006464 immune system process GO:0002376 membrane organization GO:0061024 ... |
| 7 | Q8NA66 | CNBD1 | 0.64394 | |
| 8 | Q9H9Q2 | COPS7B | 0.64123 | biological process involved in symbiotic interaction GO:0044403 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 9 | Q9BQS8 | FYCO1 | 0.64022 | catabolic process GO:0009056 cytoskeleton-dependent intracellular transport GO:0030705 transport GO:0006810 |
| 10 | A6NMN3 | FAM170B | 0.6379 | reproduction GO:0000003 |
20 40 60 80 100 AA: MEQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDSCDLGLLSSPCWRLPGVYWQNGLSPGVQSTLEPSTAKPTEFSWPGTQKQQ STMI: DO_DISOPRED3: DD.............DDDDDDDDDDDDD...............................................DDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ...............DDDDDDDDDDDDDDDDDD.........................................D..DDDDD.DDDDDDDDDDDDDDDDD DO_SPOTD: DD..............DDDDD............................DDDD...................DDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: DD.............DDDDDDDDDDDDD..............................................DDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: .............................................................................DDDDDDDDDDDDDDDDDDDDDDD RICH_[Q]: QkQQ RICH_[T]: TlepsTakpTefswpgT RICH_[EQ]: EfswpgtQkQQ RICH_MOBI_[Q]: QkQQ RICH_MOBI_[T]: TlepsTakpTefswpgT RICH_MOBI_[EQ]: EfswpgtQkQQ
120 140 160 180 AA: EAPVEEVGQAEEPDRLRLQQLPWSSPLHPWDRQQDTEVCDSGCLLERRHPPALQPWRHLPGFSDCLEWILRVGFAAFSVLWACCSRICGAKQP STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................DD DO_IUPRED2A: DDDDDDDDDDDD..DD............................................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................DDDDD CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................DD CONSENSUS_MOBI: DDDDDDDDDDD.................................................................................. RICH_[PW]: PdrlrlqqlPWssPlhPW RICH_[QW]: QQlpWssplhpWdrQQ RICH_[E]: EapvEEvgqaEE RICH_[Q]: eapveevgQ QQlpwssplhpwdrQQ RICH_[CD]: DrqqDtevCDsgC RICH_[EQ]: EapvEEvgQaEE RICH_[LP]: PdrLrLqqLPwssPLhP RICH_[LQ]: LrLQQLpwsspLhpwdrQQ RICH_[LW]: LrLqqLpWsspLhpW RICH_MOBI_[Q]: eapveevgQ RICH_MOBI_[EQ]: EapvEEvgQ