Q3ZCQ3 F174B_HUMAN

Gene name: FAM174B
Protein name: Membrane protein FAM174B

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q2TAP0 GOLGA7B 0.68413 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
protein targeting GO:0006605
...
2 Q99932 SPAG8 0.66293 biosynthetic process GO:0009058
cell cycle GO:0007049
cell differentiation GO:0030154
...
3 Q32P44 EML3 0.65358 cytoskeleton organization GO:0007010
4 Q9NSA2 KCND1 0.64956 cellular component assembly GO:0022607
circulatory system process GO:0003013
protein-containing complex assembly GO:0065003
...
5 Q9BRK4 LZTS2 0.63902 anatomical structure development GO:0048856
cell cycle GO:0007049
cell division GO:0051301
...
6 Q01546 KRT76 0.63541 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
7 Q8NAC3 IL17RC 0.63364 immune system process GO:0002376
response to stress GO:0006950
signal transduction GO:0007165
8 Q9UHV5 RAPGEFL1 0.63304 anatomical structure development GO:0048856
signal transduction GO:0007165
9 O15482 TEX28 0.63069
10 Q9BRP0 OVOL2 0.62597 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...

                                           20                  40                  60                  80                 100
AA:                      MRAVPLPAPLLPLLLLALLAAPAARASRAESVSAPWPEPERESRPPPGPGPGNTTRFGSGAAGGSGSSSSNSSGDALVTRISILLRDLPTLKAAVIVAFA
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSSSS                                                                MMMMMMMMMM
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................
DO_IUPRED2A:             .............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                         DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........          
CONSENSUS_MOBI:                                    ...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................          
RICH_[G]:                                                               GpGpGnttrfGsGaaGGsG                                  
RICH_[P]:                                                  PwPePeresrPPPgPgP                                                 
RICH_[S]:                                                                          SgaaggSgSSSSnSS                           
RICH_[EP]:                                            EsvsaPwPEPErEsrPPPgP                                                   
RICH_[GP]:                                                     PeresrPPPGPGPGnttrfGsGaaGG                                    
RICH_[GS]:                                                                  GnttrfGSGaaGGSGSSSSnSSG                          
RICH_fLPS_[P]:                                          vsaPwPePeresrPPPgPgP                                                 
RICH_fLPS_[S]:                                                                     SgaaggSgSSSSnSS                           
RICH_fLPS_[SG]:                                                                  fGSGaaGGSGSSSSnSSG                          
RICH_fLPS_[G]:                                                         pGpGpGnttrfGsGaaGGsG                                  
RICH_fLPS_[GP]:                                            PwPePeresrPPPGPGPGnttrfGsGaaGG                                    
RICH_fLPS_[GS]:                                                         GpGpGnttrfGSGaaGGSGSSSSnSSG                          
RICH_MOBI_[G]:                                                          GpGpGnttrfGsGaaGGsG                                  
RICH_MOBI_[P]:                                             PwPePeresrPPPgPgP                                                 
RICH_MOBI_[S]:                                                                     SgaaggSgSSSSnSS                           
RICH_MOBI_[EP]:                                       EsvsaPwPEPErEsrPPPgP                                                   
RICH_MOBI_[GP]:                                                PeresrPPPGPGPGnttrfG                                          
RICH_MOBI_[GS]:                                                             GnttrfGSGaaGGSGSSSSnSSG                          
RICH_fLPS_MOBI_[S]:                                                                     gSgSSSSnSS                           
RICH_fLPS_MOBI_[SG]:                                                             fGSGaaGGSGSSSSnSSG                          
RICH_fLPS_MOBI_[G]:                                                    pGpGpGnttrfGsGaaGGsG                                  

                                          120                 140 
AA:                      FTTLLIACLLLRVFRSGKRLKKTRKYDIITTPAERVEMAPLNEEDDEDEDSTVFDIKYR
STMI:                    MMMMMMMMMMM                                                
DO_DISOPRED3:            ..........................................DDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ........................D.........DDDDDDDDDDD.D............
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                          .............D.........DDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:                     ................................................
RICH_[D]:                                                            DDeDeDstvfD    
RICH_[E]:                                                    EmaplnEEddEdE          
RICH_[DE]:                                                   EmaplnEEDDEDEDstvfD