Q496H8 NRN1L_HUMAN

Gene name: NRN1L
Protein name: Neuritin-like protein

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- cell morphogenesis GO:0000902
- growth GO:0040007

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q96JB2 COG3 0.81432 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
protein transport GO:0015031
...
2 P49683 PRLHR 0.79034 reproduction GO:0000003
signal transduction GO:0007165
3 Q8WWH5 TRUB1 0.72326 cellular nitrogen compound metabolic process GO:0034641
4 O00116 AGPS 0.71989 biosynthetic process GO:0009058
protein targeting GO:0006605
protein transport GO:0015031
...
5 A6NIE6 RRN3P2 0.70277 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
6 Q6ZMK1 CYHR1 0.69124
7 O95319 CELF2 0.68661 cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
circulatory system process GO:0003013
...
8 Q9Y2U2 KCNK7 0.68328 transmembrane transport GO:0055085
transport GO:0006810
9 O15212 PFDN6 0.67597 cellular component assembly GO:0022607
protein folding GO:0006457
protein-containing complex assembly GO:0065003
10 Q96T76 MMS19 0.67319 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...

                                           20                  40                  60                  80                 100
AA:                      MMRCCRRRCCCRQPPHALRPLLLLPLVLLPPLAAAAAGPNRCDTIYQGFAECLIRLGDSMGRGGELETICRSWNDFHACASQVLSGCPEEAAAVWESLQQ
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS                                                                 
DO_DISOPRED3:            DDDDDDDDD..DDD.D..DDDDD.DDDDDD......................................................................
DO_IUPRED2A:             .................................................................................................DDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................
CONSENSUS:                                                  .................................................................
CONSENSUS_MOBI:                                             .................................................................

                                          120                 140                 160               
AA:                      EARQAPRPNNLHTLCGAPVHVRERGTGSETNQETLRATAPALPMAPAPPLLAAALALAYLLRPLA
STMI:                                                                                     
DO_DISOPRED3:            ....................DDDDDDDDDDDD.DDDDDD.DDDDDDDDDDDDD.DDD........
DO_IUPRED2A:             ..D..D..DD...........DDDDDDDDDDDDDDDDDDDD........................
DO_SPOTD:                ..................DDDDDDDDDDDDDDDDDDDDDDD.D.DDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ....................DDDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDDDDDD........
CONSENSUS_MOBI:          .................................................................
RICH_[AL]:                                                             AppLLAAALAL        
RICH_[A]:                                                            ApAppllAAAlA         
RICH_[T]:                                         TgseTnqeTlraT                           
RICH_fLPS_[A]:                                                       ApAppllAAA