Q4LEZ3 AARD_HUMAN
Gene name: AARD
Protein name: Alanine and arginine-rich domain-containing protein
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q0P6D2 | DIPK1C | 0.96718 | |
| 2 | O95484 | CLDN9 | 0.79481 | cell adhesion GO:0007155 cell junction organization GO:0034330 cellular component assembly GO:0022607 |
| 3 | Q11130 | FUT7 | 0.79456 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 4 | Q96BI1 | SLC22A18 | 0.79279 | transmembrane transport GO:0055085 transport GO:0006810 |
| 5 | Q9H9A6 | LRRC40 | 0.78856 | |
| 6 | Q9BPW8 | NIPSNAP1 | 0.78206 | nervous system process GO:0050877 |
| 7 | Q9GZZ9 | UBA5 | 0.72809 | cellular protein modification process GO:0006464 nervous system process GO:0050877 response to stress GO:0006950 ... |
| 8 | Q86XM0 | CATSPERD | 0.71707 | anatomical structure development GO:0048856 cell differentiation GO:0030154 developmental maturation GO:0021700 ... |
| 9 | P05111 | INHA | 0.69492 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 10 | O75462 | CRLF1 | 0.69054 | anatomical structure development GO:0048856 cell death GO:0008219 cell population proliferation GO:0008283 ... |
20 40 60 80 100 AA: MGPGDFRRCRERISQGLQGLPGRAELWFPPRPACDFFGDGRSTDIQEEALAASPLLEDLRRRLTRAFQWAVQRAISRRVQEAAAAAAAREEQSWTGVEAT STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDD................................................DDDDDDDDDDDDDDDDDDD.......... DO_IUPRED2A: ......................................D........D.................................DD..D...D.......... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................DDDDDDDDDDDDDDDDDDDDDDDD...... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDD...............D........D.......................DDDDDDDDDDDDDDDDDDD.......... CONSENSUS_MOBI: .................................................................................................... RICH_[A]: AisrrvqeAAAAAAA RICH_[R]: RRcReRisqglqglpgR RICH_[GR]: GpGdfRRcReRisqGlqGlpGR RICH_fLPS_[A]: AisrrvqeAAAAAAA
120 140 AA: LARLRAELVEMHFQNHQLARTLLDLNMKVQQLKKEYELEITSDSQSPKDDAANPE STMI: DO_DISOPRED3: .........................................DDDDDDDDDDDDDD DO_IUPRED2A: .....................................DDDDDDDDDDDDDDDDDD DO_SPOTD: .................D......D.DDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: .....................................DDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: .......................................................