Q4LEZ3 AARD_HUMAN

Gene name: AARD
Protein name: Alanine and arginine-rich domain-containing protein

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q0P6D2 DIPK1C 0.96718
2 O95484 CLDN9 0.79481 cell adhesion GO:0007155
cell junction organization GO:0034330
cellular component assembly GO:0022607
3 Q11130 FUT7 0.79456 anatomical structure development GO:0048856
biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
...
4 Q96BI1 SLC22A18 0.79279 transmembrane transport GO:0055085
transport GO:0006810
5 Q9H9A6 LRRC40 0.78856
6 Q9BPW8 NIPSNAP1 0.78206 nervous system process GO:0050877
7 Q9GZZ9 UBA5 0.72809 cellular protein modification process GO:0006464
nervous system process GO:0050877
response to stress GO:0006950
...
8 Q86XM0 CATSPERD 0.71707 anatomical structure development GO:0048856
cell differentiation GO:0030154
developmental maturation GO:0021700
...
9 P05111 INHA 0.69492 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
10 O75462 CRLF1 0.69054 anatomical structure development GO:0048856
cell death GO:0008219
cell population proliferation GO:0008283
...

                                           20                  40                  60                  80                 100
AA:                      MGPGDFRRCRERISQGLQGLPGRAELWFPPRPACDFFGDGRSTDIQEEALAASPLLEDLRRRLTRAFQWAVQRAISRRVQEAAAAAAAREEQSWTGVEAT
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDD................................................DDDDDDDDDDDDDDDDDDD..........
DO_IUPRED2A:             ......................................D........D.................................DD..D...D..........
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................DDDDDDDDDDDDDDDDDDDDDDDD......
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDD...............D........D.......................DDDDDDDDDDDDDDDDDDD..........
CONSENSUS_MOBI:          ....................................................................................................
RICH_[A]:                                                                                         AisrrvqeAAAAAAA            
RICH_[R]:                      RRcReRisqglqglpgR                                                                             
RICH_[GR]:                GpGdfRRcReRisqGlqGlpGR                                                                             
RICH_fLPS_[A]:                                                                                    AisrrvqeAAAAAAA            

                                          120                 140     
AA:                      LARLRAELVEMHFQNHQLARTLLDLNMKVQQLKKEYELEITSDSQSPKDDAANPE
STMI:                                                                           
DO_DISOPRED3:            .........................................DDDDDDDDDDDDDD
DO_IUPRED2A:             .....................................DDDDDDDDDDDDDDDDDD
DO_SPOTD:                .................D......D.DDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               .....................................DDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .......................................................