Q4QY38 DB134_HUMAN

Gene name: DEFB134
Protein name: Beta-defensin 134

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40                  60              
AA:                      MKPLLVVFVFLFLWDPVLAGINSLSSEMHKKCYKNGICRLECYESEMLVAYCMFQLECCVKGNPAP
STMI:                    SSSSSSSSSSSSSSSSSSS                                               
DO_DISOPRED3:            DDDDDD............................................................
DO_IUPRED2A:             ..................................................................
DO_SPOTD:                DDDDDD.DDD...................................................DDDDD
CONSENSUS:                                  ...............................................
CONSENSUS_MOBI:                             ...............................................