Q504U0 CD046_HUMAN

Gene name: C4orf46
Protein name: Renal cancer differentiation gene 1 protein

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q6NT52 CGB2 0.7872 signal transduction GO:0007165
2 P0DN86 CGB3 0.77581 biosynthetic process GO:0009058
cell death GO:0008219
cell-cell signaling GO:0007267
...
3 P26651 ZFP36 0.76599 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
4 A6NKQ9 CGB1 0.74849 signal transduction GO:0007165
5 P49279 SLC11A1 0.73932 biosynthetic process GO:0009058
catabolic process GO:0009056
cell population proliferation GO:0008283
...
6 Q9Y5K3 PCYT1B 0.7201 anatomical structure development GO:0048856
biosynthetic process GO:0009058
reproduction GO:0000003
7 Q9H6S0 YTHDC2 0.7191 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
cell cycle GO:0007049
...
8 O75385 ULK1 0.7131 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
catabolic process GO:0009056
...
9 Q8TEE9 SAP25 0.7037 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
10 Q86UY5 FAM83A 0.69963 cell population proliferation GO:0008283
signal transduction GO:0007165

                                           20                  40                  60                  80                 100
AA:                      MADPEELQVSSPPPPPPSSPSSSDASAASSPGGPVSLGWPVPSRSSGPTVDQLEEVELQIGDAAFSLTKLLEATSAVSAQVEELAFKCTENARFLKTWRD
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDDDD............................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................
RICH_[PS]:                  PeelqvSSPPPPPPSSPSSSdaSaaSSPggPvS                                                                
RICH_[AS]:                                 SpSSSdASAASS                                                                      
RICH_[P]:                   PeelqvssPPPPPPssPsssdasaassPggP                                                                  
RICH_[S]:                         SSppppppSSpSSSdaSaaSSpggpvS                                                                
RICH_[GP]:                                             PGGPvslGwPvPsrssGP                                                    
RICH_[GS]:                                           SSpGGpvSlGwpvpSrSSG                                                     
RICH_fLPS_[P]:           madPeelqvssPPPPPPssP                                                                                
RICH_fLPS_[PS]:                   SSPPPPPPSSPSSSdaSaaSSP                                                                     
RICH_fLPS_[S]:                    SSppppppSSpSSSdaSaaSS                                                                      
RICH_fLPS_[SP]:                   SSPPPPPPSSPSSSdaS                                                                          
RICH_MOBI_[PS]:             PeelqvSSPPPPPPSSPSSSdaSaaSSPggP                                                                  
RICH_MOBI_[AS]:                            SpSSSdASAASS                                                                      
RICH_MOBI_[P]:              PeelqvssPPPPPPssPsssdasaassPggP                                                                  
RICH_MOBI_[S]:                    SSppppppSSpSSSdaSaaSSpggpvS                                                                
RICH_MOBI_[GS]:                                      SSpGGpvSlGwpvpSrSSG                                                     
RICH_MOBI_[GV]:                                         GGpVslGwpV                                                           
RICH_fLPS_MOBI_[P]:         PeelqvssPPPPPPssP                                                                                
RICH_fLPS_MOBI_[S]:               SSppppppSSpSSSdaSaaSS                                                                      
RICH_fLPS_MOBI_[SP]:              SSPPPPPPSSPSSSdaS                                                                          

                                
AA:                      LLKEGYDSLKPDD
STMI:                                 
DO_DISOPRED3:            ...........DD
DO_IUPRED2A:             .....DDDDDDDD
DO_SPOTD:                .......DDDDDD
CONSENSUS:               .......DDDDDD
CONSENSUS_MOBI:          .............