Q53HI1 UNC50_HUMAN
Gene name: UNC50
Protein name: Protein unc-50 homolog
List of terms from Generic GO subset, which this protein is a part of:
- protein transport GO:0015031
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P04201 | MAS1 | 0.93116 | signal transduction GO:0007165 |
| 2 | P48039 | MTNR1A | 0.80476 | reproduction GO:0000003 signal transduction GO:0007165 |
| 3 | P51157 | RAB28 | 0.67151 | protein transport GO:0015031 signal transduction GO:0007165 transport GO:0006810 |
| 4 | Q8TB61 | SLC35B2 | 0.64018 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 signal transduction GO:0007165 ... |
| 5 | Q9GZX9 | TWSG1 | 0.59758 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
| 6 | Q9HB14 | KCNK13 | 0.57409 | transmembrane transport GO:0055085 transport GO:0006810 |
| 7 | P52740 | ZNF132 | 0.56651 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 8 | Q99676 | ZNF184 | 0.55936 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 9 | O95156 | NXPH2 | 0.5518 | signal transduction GO:0007165 |
| 10 | O43699 | SIGLEC6 | 0.55084 | cell adhesion GO:0007155 cell-cell signaling GO:0007267 |
20 40 60 80 100 AA: MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFG STMI: MMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................... CONSENSUS_MOBI: .................................................................................. RICH_[V]: VnslVqgngV RICH_[NV]: VNslVqgNgVlN
120 140 160 180 200 AA: FVLDMGFFETIKLLLWVVLIDCVGVGLLIATLMWFISNKYLVKRQSRDYDVEWGYAFDVHLNAFYPLLVILHFIQLFFINHVILTDTFIGYLVGNTLWLV STMI: MMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ............ ........................... ... CONSENSUS_MOBI: ............ ........................... ...
220 240 AA: AVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLYGLSLALGWNFTHTLCSFYKYRVK STMI: MMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ........................................................... DO_IUPRED2A: ........................................................... DO_SPOTD: ........................................................... CONSENSUS: .............. ................ CONSENSUS_MOBI: .............. ................