Q58A44 PCOTH_HUMAN

Gene name: PCOTH
Protein name: Prostate collagen triple helix protein

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9BRQ0 PYGO2 0.86243 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell population proliferation GO:0008283
...
2 Q9BWG4 SSBP4 0.85169 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
3 Q9BWW4 SSBP3 0.84986 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
4 P0CG12 DERPC 0.838
5 Q92611 EDEM1 0.83509 catabolic process GO:0009056
cellular protein modification process GO:0006464
protein transport GO:0015031
...
6 P42768 WAS 0.81804 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell morphogenesis GO:0000902
...
7 Q9Y6F9 WNT6 0.79908 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
8 Q9Y4P9 SPEF1 0.79626 cytoskeleton organization GO:0007010
9 A6NDV4 TMEM8B 0.79404 cell adhesion GO:0007155
cell cycle GO:0007049
growth GO:0040007
...
10 Q8NAC3 IL17RC 0.79371 immune system process GO:0002376
response to stress GO:0006950
signal transduction GO:0007165

                                           20                  40                  60                  80                 100
AA:                      MWILSNLMGTSEEGNLLSTVSPTVKALFGKTRVSPIFPFSPRSPFQPLIPRTPGSPWGPVGPASPLGPGFPIGPMGPGKPVGPKGPMLPLGPSGPVGPTS
STMI:                                                                                                                        
DO_DISOPRED3:            D......D............................................................................................
DO_IUPRED2A:             ............DDDD..DDDD.........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...D.
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               D......D....DDDDDDDDDD.........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ..............................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[G]:                                                                     GspwGpvGpasplGpGfpiGpmGpGkpvGpkGpmlplGpsG      
RICH_[P]:                                                                 PrtPgsPwgPvgPasPlgPgfPigPmgPgkPvgPkgPmlPlgPsgPvgPts
RICH_[GM]:                                                                                       GpMGpGkpvGpkGpM             
RICH_[GP]:                                                                PrtPGsPwGPvGPasPlGPGfPiGPmGPGkPvGPkGPmlPlGPsGPvGPts
RICH_[MP]:                                                                                        PMgPgkPvgPkgPMlP           
RICH_fLPS_[G]:                                                                            lGpGfpiGpmGpGkpvGpkG               
RICH_MOBI_[G]:                                                                GspwGpvGpasplGpGfpiGpmGpGkpvGpkGpmlplGpsG      
RICH_MOBI_[P]:                                                         PliPrtPgsPwgPvgPasPlgPgfPigPmgPgkPvgPkgPmlPlgPsgPvgPts
RICH_MOBI_[FP]:                                                                                               PmlPlgPsgPvgPts
RICH_MOBI_[GM]:                                                                              GfpiGpMGpGkpvGpkGpMlplGpsG      
RICH_MOBI_[GP]:                                                           PrtPGsPwGPvGPasPlGPGfPiGPmGPGkPvGPkGPmlPlGPsGPvGPts
RICH_MOBI_[LP]:                                                                                                 LPLgPsgPvgPts
RICH_MOBI_[MP]:                                                                             PgfPigPMgPgkPvgPkgPMlPlgP        

                                      
AA:                      PLFPFCP
STMI:                           
DO_DISOPRED3:            .....D.
DO_IUPRED2A:             D......
DO_SPOTD:                DDDDDDD
CONSENSUS:               D....D.
CONSENSUS_MOBI:          DDDDDDD
RICH_[P]:                P      
RICH_[GP]:               P      
RICH_MOBI_[P]:           PlfPfcP
RICH_MOBI_[FP]:          PlFPFcP
RICH_MOBI_[GP]:          PlfP   
RICH_MOBI_[LP]:          PL