Q5BIV9 SPRN_HUMAN

Gene name: SPRN
Protein name: Shadow of prion protein

List of terms from Generic GO subset, which this protein is a part of:
- nucleocytoplasmic transport GO:0006913
- protein transport GO:0015031
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O95622 ADCY5 0.69718 biosynthetic process GO:0009058
cell-cell signaling GO:0007267
cellular nitrogen compound metabolic process GO:0034641
...
2 O43541 SMAD6 0.68997 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
3 Q6PID8 KLHDC10 0.68439 cellular protein modification process GO:0006464
response to stress GO:0006950
signal transduction GO:0007165
4 Q9NR19 ACSS2 0.67429 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
generation of precursor metabolites and energy GO:0006091
...
5 Q8NAA5 LRRC75A 0.65837
6 O00287 RFXAP 0.65128 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
7 Q9P0K9 FRRS1L 0.64927 signal transduction GO:0007165
8 Q9H461 FZD8 0.64672 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
9 Q86V81 ALYREF 0.64599 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
10 O15105 SMAD7 0.64569 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...

                                           20                  40                  60                  80                 100
AA:                      MNWAPATCWALLLAAAFLCDSGAAKGGRGGARGSARGGVRGGARGASRVRVRPAQRYGAPGSSLRVAAAGAAAGAAAGAAAGLAAGSGWRRAAGPGERGL
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSS                                                                            
DO_DISOPRED3:            DD.......................DDDDDDDDDDDDDDDDDDDDDD.....................DDDDDDDDDDDDDDDDDD...DDD........
DO_IUPRED2A:             ...........................DDDDDDDDDDDDD.DDDDD...DDDD......................................DDDDDDDDD
DO_SPOTD:                .....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                       .DDDDDDDDDDDDDDDDDDDDDDDDDDDD...............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:                                  ................................................................DDDDDDDDDDDD
RICH_[AG]:                                         GrGGArGsArGGvrGGArGA                      AGAAAGAAAGAAAGlAAGsGwrrAAGpGerG 
RICH_[AR]:                                          RggARgsARggvRggARgAsRvR                                                  
RICH_[A]:                                                                                    AgAAAgAAAgAAAglAAgsgwrrAA       
RICH_[RV]:                                                     VRggaRgasRVRVR                                                
RICH_[G]:                                         GGrGGarGsarGGvrGGarG                            GaaaGaaaGlaaGsGwrraaGpG    
RICH_[R]:                                           RggaRgsaRggvRggaRgasRvRvR                                                
RICH_[EG]:                                                                                                    GsGwrraaGpGErGl
RICH_[GR]:                                        GGRGGaRGsaRGGvRGGaRGasRvRvR                                     RRaaGpGeRG 
RICH_[GV]:                                                   GGVrGGarGasrVrV                                                 
RICH_fLPS_[A]:                                                                               AgAAAgAAAgAAAglAA               
RICH_fLPS_[R]:                                          RgsaRggvRggaRgasRvRvR                                                
RICH_fLPS_[G]:                                    GGrGGarGsarGGvrGGarG                                                       
RICH_fLPS_[GR]:                                   GGRGGaRGsaRGGvRGGaRGasRvRvR                                                
RICH_MOBI_[G]:                                                                                                        GpGerGl
RICH_MOBI_[EG]:                                                                                                       GpGErGl
RICH_MOBI_[GR]:                                                                                                   RRaaGpGeRG 

                                          120                 140         
AA:                      EDEEDGVPGGNGTGPGIYSYRAWTSGAGPTRGPRLCLVLGGALGALGLLRP
STMI:                                                                       
DO_DISOPRED3:            ...................................................
DO_IUPRED2A:             DDDDDDDDDDDD.......DDDDD...........................
DO_SPOTD:                DDDDDDDDDDDDD....................................DD
CONSENSUS:               DDDDDDDDDDDD.......................................
CONSENSUS_MOBI:          DDDDDDDDDDDDD......................................
RICH_[EG]:               EdEEdGvpGGnG                                       
RICH_MOBI_[G]:           edeedGvpGGnG                                       
RICH_MOBI_[EG]:          EdEEdGvpGGnG