Q5BN46 CI116_HUMAN
Gene name: C9orf116
Protein name: UPF0691 protein C9orf116
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P25786 | PSMA1 | 0.72226 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 2 | Q9BTL4 | IER2 | 0.66729 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 3 | P55884 | EIF3B | 0.63059 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 cellular component assembly GO:0022607 ... |
| 4 | O94819 | KBTBD11 | 0.63056 | |
| 5 | Q14896 | MYBPC3 | 0.60789 | anatomical structure development GO:0048856 cell adhesion GO:0007155 circulatory system process GO:0003013 ... |
| 6 | Q99536 | VAT1 | 0.60505 | anatomical structure development GO:0048856 immune system process GO:0002376 transport GO:0006810 ... |
| 7 | Q13203 | MYBPH | 0.60164 | cell adhesion GO:0007155 |
| 8 | A5LHX3 | PSMB11 | 0.60136 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 9 | Q86UX6 | STK32C | 0.59492 | cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 10 | P29966 | MARCKS | 0.59409 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 |
20 40 60 80 100 AA: MAEECPRACAEPVAPKATAPPERTSDYYRVSADLPGRFNNPGWFRGYRTQKAVSVYRTSNQAYGSRAPTVHEMPKVFYPNSNKFSQQLAAGGMFRNNTLN STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDD............................................................................... DO_IUPRED2A: ..........DDDDDDD.DDDDDDDDD..DD..........................DD....DDDD................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDD............................................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDD............................................................................ CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDD............................................................................ RICH_[AC]: AeeCprACAepvApkAtA RICH_[AE]: AEEcprAcAEpvApkAtAppE RICH_[AP]: AeecPrAcAePvAPkAtAPP RICH_[A]: AeecprAcAepvApkAtA RICH_[CE]: EECpraCaEpvapkatappE RICH_[CP]: CPraCaePvaPkataPP RICH_[EP]: EEcPracaEPvaPkataPPE RICH_MOBI_[AC]: AeeCprACAepvApkAtA RICH_MOBI_[AE]: EEcprAcAEpvApkAtAppE RICH_MOBI_[AP]: PvAPkAtAPP RICH_MOBI_[A]: AeecprAcAepvApkAtA RICH_MOBI_[CE]: EECpraCaEpvapkatappE
120 AA: VYLEKSIVTGPDNCITSCDRLNFHPSYNINRPSICD STMI: DO_DISOPRED3: .................................... DO_IUPRED2A: .................................... DO_SPOTD: ..............................DDDDDD CONSENSUS: .................................... CONSENSUS_MOBI: ....................................