Q5H9J7 BEX5_HUMAN

Gene name: BEX5
Protein name: Protein BEX5

List of terms from Generic GO subset, which this protein is a part of:
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P62136 PPP1CA 0.51971 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
2 Q9BXM7 PINK1 0.51478 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
3 P48546 GIPR 0.50812 anatomical structure development GO:0048856
cell-cell signaling GO:0007267
generation of precursor metabolites and energy GO:0006091
...
4 Q96DH6 MSI2 0.50793 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular nitrogen compound metabolic process GO:0034641
5 Q9H598 SLC32A1 0.49248 anatomical structure development GO:0048856
cell-cell signaling GO:0007267
transmembrane transport GO:0055085
...
6 Q9BUU2 METTL22 0.48354 cellular protein modification process GO:0006464
7 P50895 BCAM 0.48048 cell adhesion GO:0007155
signal transduction GO:0007165
8 P0DMV9 HSPA1B 0.46029 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
9 P11142 HSPA8 0.45023 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
10 Q8NE28 STKLD1 0.44934

                                           20                  40                  60                  80                 100
AA:                      MENVPKENKVVEKAPVQNEAPALGGGEYQEPGGNVKGVWAPPAPGFGEDVPNRLVDNIDMIDGDGDDMERFMEEMRELRRKIRELQLRYSLRILIGDPPH
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDD.D.........................................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DD.DDDDDDDDDDDDD..DDDDDDDDDDD.D...................D....
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..D...D..D...D..DDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................D....
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............................................................
RICH_[D]:                                                                DvpnrlvDniDmiDgDgDD                                 
RICH_[G]:                                       GGGeyqepGGnvkG                                                               
RICH_[V]:                   VpkenkVVekapV                                                                                    
RICH_[DI]:                                                               DvpnrlvDnIDmIDgDgDD                                 
RICH_[DM]:                                                                      DniDMiDgDgDDM                                
RICH_[EV]:                EnVpkEnkVVEkapVqnE                                                                                 
RICH_[GP]:                                       GGeyqePGGnvkGvwaPPaPGfGedvP                                                 
RICH_[IN]:                                                                  NrlvdNIdmI                                       
RICH_[KV]:                  VpKenKVVeK                                                                                       
RICH_fLPS_[D]:                                                          eDvpnrlvDniDmiDgDgDD                                 
RICH_fLPS_[G]:                                 lGGGeyqepGGnvkG                                                               
RICH_MOBI_[G]:                                  GGGeyqepGGnvkG                                                               
RICH_MOBI_[V]:              VpkenkVVekapV                                                                                    
RICH_MOBI_[EV]:           EnVpkEnkVVEkapVqnE                                                                                 
RICH_MOBI_[KV]:             VpKenKVVeK                                                                                       

                                  
AA:                      HDHHDEFCLMP
STMI:                               
DO_DISOPRED3:            ...DDD.....
DO_IUPRED2A:             .D.DDDDDDD.
DO_SPOTD:                DDDDD...DDD
CONSENSUS:               .DDDDDDDDD.
CONSENSUS_MOBI:          ...........