Q5HYR2 DMRTC_HUMAN

Gene name: DMRTC1;
Protein name: Doublesex- and mab-3-related transcription factor C1

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q02246 CNTN2 0.92576
2 Q9UQ52 CNTN6 0.92576
3 Q86TP1 PRUNE1 0.92576 anatomical structure development GO:0048856
catabolic process GO:0009056
cell differentiation GO:0030154
...
4 Q8IY18 SMC5 0.91622 cell cycle GO:0007049
cell division GO:0051301
cellular nitrogen compound metabolic process GO:0034641
...
5 P46098 HTR3A 0.91554 cell-cell signaling GO:0007267
nervous system process GO:0050877
signal transduction GO:0007165
...
6 O75880 SCO1 0.91374 catabolic process GO:0009056
cellular component assembly GO:0022607
homeostatic process GO:0042592
...
7 P50281 MMP14 0.90957 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
catabolic process GO:0009056
...
8 Q5VTD9 GFI1B 0.89467 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
9 O43613 HCRTR1 0.87948 cell-cell signaling GO:0007267
cellular protein modification process GO:0006464
homeostatic process GO:0042592
...
10 A0PG75 PLSCR5 0.87523 membrane organization GO:0061024
plasma membrane organization GO:0007009
transport GO:0006810

                                           20                  40                  60                  80                 100
AA:                      MAAPPKAPIRVRNLTIRAGALTGKENNMLQPETHIFTAPEEGSSQGALLLGQAPEPLSLPCTPVTLEQQLVSPSGDPHRAPALPSICSTLILQPCATLDP
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....DDD.....D...................D............................
DO_IUPRED2A:             DDD.D...............DDDDD.DDDDDDDDDDDDDDDD..DDDDDD........DDDDDDDDDDDDDDDDDDDDD.....................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......DDDDDDDDDDDDDDDDDDDDD.....................
CONSENSUS_MOBI:          ....................................................................................................
RICH_[GL]:                                                        GssqGaLLLG                                                 

                                          120                 140                 160                 180        
AA:                      LLLQPQVPKVSDQALVSAHSEWQRKLEAAEALLTLRNSAQAPPDSISLHQPCNPPAPAGDKGFQPPSPSLRPRPASSISLPIGHLGCISLLS
STMI:                                                                                                                
DO_DISOPRED3:            .................................................DDDDDDDDDDDDDDDDDDDDDDDDDDD................
DO_IUPRED2A:             ..D..........DD..D..D...........DDD.D..DD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ..D..........DDDDDDDD...........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................
CONSENSUS_MOBI:          .........................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................
RICH_[AP]:                                                     AqAPPdsislhqPcnPPAPA                                  
RICH_[P]:                                                         PPdsislhqPcnPPaPagdkgfqPPsPslrPrP                  
RICH_fLPS_[P]:                                                                PPaPagdkgfqPPsPslrPrP                  
RICH_MOBI_[P]:                                                    PPdsislhqPcnPPaPagdkgfqPPsPslrPrP