Q5JQF8 PAP1M_HUMAN
Gene name: PABPC1L2A
Protein name: Polyadenylate-binding protein 1-like 2
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6UXM1 | LRIG3 | 0.8127 | anatomical structure development GO:0048856 embryo development GO:0009790 |
| 2 | Q9BWW8 | APOL6 | 0.71332 | transport GO:0006810 |
| 3 | Q9BS91 | SLC35A5 | 0.69189 | transport GO:0006810 |
| 4 | Q9Y2D4 | EXOC6B | 0.68095 | protein transport GO:0015031 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 5 | Q8IV61 | RASGRP3 | 0.67787 | cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 6 | Q12846 | STX4 | 0.67126 | cell adhesion GO:0007155 cell death GO:0008219 cell population proliferation GO:0008283 ... |
| 7 | Q8IVU9 | CABCOCO1 | 0.66879 | |
| 8 | B4DJY2 | TMEM233 | 0.66778 | |
| 9 | P63252 | KCNJ2 | 0.65759 | cellular component assembly GO:0022607 circulatory system process GO:0003013 homeostatic process GO:0042592 ... |
| 10 | O43156 | TTI1 | 0.64856 | signal transduction GO:0007165 |
20 40 60 80 100 AA: MASLYVGDLHPEVTEAMLYEKFSPAGPILSIRICRDKITRRSLGYAYVNYQQPVDAKRALETLNFDVIKGRPVRIMWSQRDPSLRKSGVGNVFIKNLGKT STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 AA: IDNKALYNIFSAFGNILSCKVACDEKGPKGYGFVHFQKQESAERAIDVMNGMFLNYRKIFVGRFKSHKEREAERGAWARQSTSADVKDFEEDTDEEATLR STMI: DO_DISOPRED3: ..........................................................................DDDDD....................D DO_IUPRED2A: .......................................................................DD.DDDD.........DDD......D..D DO_SPOTD: ...............................................................................................DD.DD CONSENSUS: ..........................................................................DDDD..................D..D CONSENSUS_MOBI: .....................................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD RICH_MOBI_[AR]: ReAeRgAwAR RICH_MOBI_[D]: DvkDfeeDtD RICH_MOBI_[DE]: DvkDfEEDtDEE