Q5SWW7 CJ055_HUMAN
Gene name: C10orf55
Protein name: Uncharacterized protein C10orf55
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O14579 | COPE | 0.88492 | protein transport GO:0015031 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 2 | Q9UPM9 | B9D1 | 0.88492 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular component assembly GO:0022607 ... |
| 3 | Q9UM00 | TMCO1 | 0.88492 | homeostatic process GO:0042592 response to stress GO:0006950 signal transduction GO:0007165 ... |
| 4 | Q9NZH0 | GPRC5B | 0.88492 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell-cell signaling GO:0007267 ... |
| 5 | A4D126 | CRPPA | 0.79149 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 6 | Q5JXX5 | n/a | 0.76274 | |
| 7 | Q96PJ5 | FCRL4 | 0.71738 | immune system process GO:0002376 signal transduction GO:0007165 |
| 8 | Q96DH6 | MSI2 | 0.71706 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular nitrogen compound metabolic process GO:0034641 |
| 9 | Q96H96 | COQ2 | 0.69584 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 small molecule metabolic process GO:0044281 |
| 10 | O14734 | ACOT8 | 0.6803 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
20 40 60 80 100 AA: MFLHLDSHSSLERTKPTVVGVDTHMELDEVHCCPGRDSGGGFIKGPMLQGLQGEGKLAPIPKPTLPSPSRLTLFVSSSQMEDHGFPARRNGLTQASFIYQ STMI: DO_DISOPRED3: D.DD................................................................................................ DO_IUPRED2A: ............DDDDDDDDDD.......DDD..........DDDDD.D...DDDDDDDDDDDD....D.DDDD.D.......DDDDD............ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............DD....DDDD........ CONSENSUS: DDDD........DDDDDDDDDD.......DDD..........DDDDDDDDDDDDDDDDDDDDDD....D..............D................ CONSENSUS_MOBI: .................................................................................................... RICH_[GL]: LqGLqGeGkL RICH_[GP]: GPmlqGlqGeGklaPiPkP
120 140 AA: MPAGWGSPGGLFLPCQPVPTPVVLKPPLPPCPISWGESGPAVDGIRRTPAP STMI: DO_DISOPRED3: ......................................D..DDDDDDDDDD DO_IUPRED2A: ............................D....DDD..DDDDDDDDDDDDD DO_SPOTD: .................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ............................D....DDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ...................................................