Q5T035 CI129_HUMAN

Gene name: C9orf129
Protein name: Putative uncharacterized protein C9orf129

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P54259 ATN1 0.66342 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell death GO:0008219
...
2 Q9UPX0 IGSF9B 0.6453 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell junction organization GO:0034330
...
3 P47902 CDX1 0.637 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
4 Q9ULJ6 ZMIZ1 0.63266 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
5 O14559 ARHGAP33 0.63101 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell junction organization GO:0034330
...
6 O14529 CUX2 0.62591 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
7 Q9P206 KIAA1522 0.62149 cell differentiation GO:0030154
8 Q9H3S7 PTPN23 0.61861 catabolic process GO:0009056
cell adhesion GO:0007155
cell junction organization GO:0034330
...
9 O15027 SEC16A 0.61628 anatomical structure development GO:0048856
cellular component assembly GO:0022607
membrane organization GO:0061024
...
10 P08151 GLI1 0.61383 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...

                                           20                  40                  60                  80                 100
AA:                      MPGMVPPHVPPQMLNIPQTSLQAKPVAPQVPSPGGAPGQGPYPYSLSEPAPLTLDTSGKNLTEQNSYSNIPHEGKHTPLYERSLPINPAQSGSPNHVDSA
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDD.......D..........DDDDDDDDDDDD.DDD..........................................................DD.
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[PQ]:                        PPQmlniPQtslQakPvaPQvP                                                                     
RICH_[PY]:                                       PvaPqvPsPggaPgqgPYPYslsePaP                                                 
RICH_[M]:                MpgMvpphvppqM                                                                                       
RICH_[N]:                                                                           NlteqNsysN                               
RICH_[P]:                 PgmvPPhvPPqmlniP       PvaPqvPsPggaPgqgPyP                                                         
RICH_[Q]:                           QmlnipQtslQakpvapQ                                                                       
RICH_[S]:                                                                                                          SgSpnhvdSa
RICH_[GP]:                                       PvaPqvPsPGGaPGqGPyPyslsePaP                                                 
RICH_[GY]:                                                GGapGqGpYpY                                                        
RICH_[LY]:                                                        YpYsLsepapLtLdtsgknL                                       
RICH_[MP]:               MPgMvPPhvPPqMlniP                                                                                   
RICH_fLPS_[S]:                                                                                                     SgSpnhvdSa
RICH_MOBI_[PV]:           PgmVPPhVPP                                                                                         
RICH_MOBI_[PY]:                                  PvaPqvPsPggaPgqgPYPY                                                        
RICH_MOBI_[L]:                                                        LsepapLtLdtsgknL                                       
RICH_MOBI_[M]:           MpgMvpphvppqM                                                                                       
RICH_MOBI_[N]:                                                                      NlteqNsysN                               
RICH_MOBI_[P]:            PgmvPPhvPPqmlniP       PvaPqvPsPggaPgqgPyP                                                         
RICH_MOBI_[Q]:                      QmlnipQtslQakpvapQ                                                                       
RICH_MOBI_[S]:                                                                                                     SgSpnhvdSa
RICH_MOBI_[Y]:                                                                             YsniphegkhtplY                    
RICH_MOBI_[GP]:                                  PvaPqvPsPGGaPGqGPyP                                                         
RICH_MOBI_[GY]:                                           GGapGqGpYpY                                                        
RICH_MOBI_[IY]:                                                                            YsnIphegkhtplYerslpI              
RICH_MOBI_[LY]:                                                   YpYsLsepapLtLdtsgknL                                       
RICH_MOBI_[MP]:          MPgMvPPhvPPqMlniP                                                                                   
RICH_fLPS_MOBI_[S]:                                                                                                SgSpnhvdSa
RICH_fLPS_MOBI_[M]:      MpgMvpphvppqMln                                                                                     

                                          120                 140                 160                 180    
AA:                      YFPGSSTSSSSDNDEGSGGATKYTIYWGFRATDHHVQGRDSQARGTAAHWHGGHVCSPNVFWRISHGPAQQLTFPTEQAAPPVCPAPASRRLSAPG
STMI:                                                                                                                    
DO_DISOPRED3:            ..DDDDDDDDDDDDDDD.................DDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDD.....D.DDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDD.D.............DDDDDDDDDDDDDDDDDD.........D.....DDD.DDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDD.............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDD.........................................................DDDDDDDDDDDDDDDDDDDDD
RICH_[AP]:                                                                                  PAqqltfPteqAAPPvcPAPAsrrlsAP 
RICH_[A]:                                                                                              AAppvcpApA        
RICH_[H]:                                                 HHvqgrdsqargtaaHwHggH                                          
RICH_[P]:                                                                                   PaqqltfPteqaaPPvcPaP         
RICH_[S]:                yfpgSStSSSSdndegS                                                                               
RICH_[W]:                                                                 WhgghvcspnvfW                                  
RICH_[GH]:                                                HHvqGrdsqarGtaaHwHGGH                                          
RICH_[GS]:                  GSStSSSSdndeGSGG                                                                             
RICH_[HW]:                                                               HWHggHvcspnvfWrisH                              
RICH_fLPS_[S]:           yfpgSStSSSSdndegS                                                                               
RICH_MOBI_[AP]:                                                                                        AAPPvcPAPA        
RICH_MOBI_[A]:                                                                                         AAppvcpApA        
RICH_MOBI_[S]:           yfpgSStSSSSdndegS                                                                               
RICH_fLPS_MOBI_[S]:      yfpgSStSSSS